KEGG   Thermotoga sp. RQ2: TRQ2_0391Help
Entry
TRQ2_0391         CDS       T00706                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
trq  Thermotoga sp. RQ2
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TRQ2_0391
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TRQ2_0391
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TRQ2_0391
Enzymes [BR:trq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TRQ2_0391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
381318..382364
Genome map
AA seq 348 aa AA seqDB search
MKLGILEKYRRFLPVTDKTPMLSLNEGNTPLIPLVNMSRELGINIYVKYEGSNPTGSFKD
RGMVVAVAKALEEGSKAIMCASTGNTSASAAAYAARAGIKAIVLIPEGKIALGKLAQAMI
YGAVVLQVRGNFDKCLELVKEITSKYPITLVNSINPYRLEGQKTAAFEIVDELGDAPDYH
FIPVGNAGNISAYWMGYKEYYQHGFSTKLPKMMGFQAEGAAPIVRGHPIENPETVATAIR
IGNPANWEKAVRARDESGGDIDMVSDEEILRAQRLLAQKEGIFCEPASAASIAGLLKKHR
QGIFRGGEIVVCTLTGNGLKDPNIVISQLEPPRTIEGRVEEILEVLDI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgggcatactcgaaaagtacagaagatttcttcccgtaacagacaaaaccccc
atgctctctttgaatgaagggaacactcctctcatacctcttgtgaacatgagcagggaa
ctcggaataaacatctacgtgaagtacgaaggatccaatccgacggggtccttcaaagat
agaggaatggtcgttgccgtcgcaaaggcactggaagaaggctcgaaagccatcatgtgc
gcttcaacggggaacacctccgcatccgctgccgcgtacgccgcaagggcgggaataaag
gcgatcgttctgataccagaagggaagatcgcactcggaaagctggctcaggcgatgata
tacggcgccgtggtgcttcaggtgagagggaatttcgacaagtgtctggaactggtcaag
gagatcacatccaaatatcccatcacactcgtgaacagtatcaatccctacagactcgaa
ggtcagaaaacggccgcttttgagatagtcgacgagctcggagatgcaccggactaccac
ttcatccccgtgggaaacgcgggcaacatctccgcttactggatgggatacaaggagtat
tatcagcatggattctccaccaagcttccaaagatgatgggattccaggcggaaggggcc
gcccccatagttcgcggtcatcccatagaaaacccggagacggtcgccactgcaataagg
atcggtaaccccgcgaactgggaaaaagcggtccgggcacgcgatgaatcgggtggagac
atcgacatggtgagcgacgaagaaatactgcgcgcacagagactcttggctcagaaagaa
gggatcttctgtgagcccgcatccgctgcatcgatagcggggcttttgaagaagcacaga
cagggaatcttcaggggtggagagatcgttgtgtgtaccctcacagggaacggtttgaaa
gatccgaacatcgtcatctcacagctcgaacccccaaggaccatagaaggaagagtagaa
gagattctggaggtactcgacatatga

DBGET integrated database retrieval system