KEGG   Thermotoga sp. RQ2: TRQ2_0398Help
Entry
TRQ2_0398         CDS       T00706                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
trq  Thermotoga sp. RQ2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TRQ2_0398
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TRQ2_0398
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TRQ2_0398
Enzymes [BR:trq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TRQ2_0398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
387648..388916
Genome map
AA seq 422 aa AA seqDB search
MRIVVNLKPEEIPKHWYNVLADLPFKLDPPLDPETKQPISPEKLSVIFPMSLIEQEVSEE
RFIEIPEPVLKEYAVYRPTPLIRATFLEEYLQTPARIYYKYEGVSPTGSHKPNTAIAQAY
YNKTEGVKRLVTETGAGQWGSALSYAGAKFGLEVKVFMVKISYQQKPMRKYMMNLFGGKV
TPSPSEETNFGRKILSEDPDNPGSLGIAISEALEVAVSDPNTKYSLGSVLNHVLLHQTVI
GLEIKKQLELIGEKPDILLGCHGGGSNFGGTILPFVPDKLSGRDIRFVACEPAACPSLTK
GNYDYDFGDTAGLTPLLKMYTLGKDFIPPKIHAGGLRYHGSAPIIARLVKEGLVEAQAFD
QDETFEAAKIFAKLEGIIPAPESAHAIAGAIREAKKAKEEGKERVIVFTLSGHGLLDLTA
YV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgttgtgaatttgaaacctgaggaaattccaaagcactggtacaacgtactc
gcagatcttccgttcaaactcgatccgccgctggaccccgaaacgaaacaacccatttca
cccgagaagctctctgttatcttccccatgagtctgatcgaacaggaggtctcagaagag
cggttcatcgaaatacccgagcccgttctgaaagaatacgccgtttacagacccactccc
ctcatcagagccactttcttagaagagtacctccagactccggcgaggatctactacaag
tacgaaggagtgagccccactggaagccacaagccgaacacggccatcgcccaggcctac
tacaacaaaaccgaaggagtcaaaagactcgtcacagaaacgggagcgggacaatggggc
agcgctctctcgtacgccggcgccaagttcgggctggaagtgaaagtgttcatggtgaag
atcagttaccagcaaaagccgatgagaaaatacatgatgaacctcttcggaggaaaggta
actccaagccccagtgaagaaacgaatttcggaagaaagatcctgagtgaagatccagac
aatccaggtagtcttggcatcgccatcagtgaagcactggaagtggccgtgtctgatccg
aacacgaagtactccctcggaagcgtattgaaccatgttctgctccaccagacggttata
ggcctcgaaatcaagaaacagctcgaactcataggtgaaaaaccagacatcttactggga
tgtcacggaggaggatcgaattttggaggaacgatacttcccttcgttccagacaaactt
tccggaagggatatcaggttcgtcgcctgcgagcccgccgcgtgtccatccttgacgaaa
gggaattacgattacgatttcggagacaccgcgggactcacacctctgctgaaaatgtac
acccttggaaaggacttcattcctccgaagatacacgcgggaggtctcagataccacggc
tccgctccgataatcgcaagactcgtgaaagaaggacttgtggaggcacaggctttcgat
caggacgagacgtttgaggcagcgaagatcttcgcaaagctcgaaggaataattcccgcc
ccggaatccgctcacgccatcgcaggagccataagggaagcaaagaaagcgaaagaagaa
ggaaaagaacgtgtgatagtattcactctgagcggccacggtctgctcgatctcacagcg
tacgtgtga

DBGET integrated database retrieval system