KEGG   Thermotoga sp. RQ2: TRQ2_0501Help
Entry
TRQ2_0501         CDS       T00706                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
trq  Thermotoga sp. RQ2
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:trq00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:trq00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
498723..500066
Genome map
AA seq 447 aa AA seqDB search
MKKVVSLLIIVLFSASFFGGALISMEKLPDATMDNPYTLTIQSQADVVISIFMNDKTVLQ
ETLLKAGNSLSVDLKFEVPRNTIRIVVRNMNNLNEEQIFVKKILYLSQVDAVVDKNFTGN
DGESVNGVPHFTSISAALEFLKNSKNDEEKRKYIFIKSGNYYEKITIDIPNLSLVGEDVL
STKIYYDDAAGKTLPDGKKIGTSKSASVTIKGSATGFTAENITFENSFDEQNNPEITSKQ
AVAVLTQSDRAVFINCRFIGNQDTLYVRNGLHYFRDCYIEGDVDFIFGDGRAVFEDCVIF
SVDRPGIKPKGYITAASTKKDNLGFLFTNCVFTSNVTDKNSVYLGRPWHPSSDPYSVNSN
VVIRESYLGEHIHMDGWTSMSSKDPKTGEKIWFYPETERFFEYQNYGPGAIINEKRPQLE
GENVELYSKEKFLDDWDVERFIEQLYQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaagtggtatcactcctcattattgtccttttctctgcatcgttttttggaggt
gcactgatatccatggaaaaactaccggacgctactatggacaatccttacactctaacc
attcaaagtcaagcagatgtggttatatccatcttcatgaacgacaaaactgttcttcaa
gaaactcttcttaaagcaggaaacagtctgagtgtggacctgaaatttgaagtgccgaga
aacaccatcagaattgtggtgagaaatatgaacaacttaaacgaagagcagatttttgtt
aaaaaaatcctgtacctttcacaagtggatgcggtcgtagataaaaacttcacaggaaac
gacggagaatcagtgaacggtgtaccgcacttcacaagcataagcgcagctcttgagttt
ttgaagaacagcaaaaatgatgaagagaagagaaaatacatcttcatcaagagcggaaac
tattacgaaaagatcaccattgacataccaaatctgagccttgtgggagaagatgttctt
tcaacaaagatttactacgatgacgcagcagggaaaacgctcccagatgggaaaaaaata
ggaacatcaaagagtgcaagtgtaaccataaaaggtagtgctacagggttcacagcagaa
aacatcactttcgaaaattcgttcgatgaacagaacaaccctgaaatcaccagcaaacag
gcggtagcggttttaacccagtctgatagagccgttttcatcaattgtcgtttcatagga
aaccaggatactctttacgtgagaaatgggttacattatttcagagattgctatatagag
ggcgatgtcgatttcatatttggcgatggacgggcagttttcgaagattgtgtcatattc
tcggtcgatagacccggaatcaaacccaaaggatacatcacagcggccagtactaaaaaa
gacaatctgggttttcttttcacaaactgtgtcttcacatcgaacgtaacggataaaaat
tctgtctatcttggaagaccgtggcatccaagttccgatccttacagtgtgaattctaac
gttgtgataagagaaagctaccttggagaacatatccacatggatggctggaccagtatg
agttctaaagatcccaaaacaggagagaaaatatggttctaccctgagacagaaaggttc
tttgagtaccaaaactacggaccgggagccataataaacgaaaaaagacctcaacttgaa
ggggagaatgtagaactctacagtaaagaaaaattccttgacgattgggacgtagaaagg
ttcatagaacaactctatcagtaa

DBGET integrated database retrieval system