KEGG   Thermotoga sp. RQ2: TRQ2_0624Help
Entry
TRQ2_0624         CDS       T00706                                 

Definition
(GenBank) L-fucose isomerase 1 domain protein
  KO
K01818  L-fucose/D-arabinose isomerase [EC:5.3.1.25 5.3.1.3]
Organism
trq  Thermotoga sp. RQ2
Pathway
trq00051  Fructose and mannose metabolism
trq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TRQ2_0624
Enzymes [BR:trq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.3  D-arabinose isomerase
     TRQ2_0624
    5.3.1.25  L-fucose isomerase
     TRQ2_0624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fucose_iso_N1 Fucose_iso_C Fucose_iso_N2
Motif
Other DBs
NCBI-ProteinID: ACB08977
UniProt: A0A0F6AKG2
Position
complement(630630..632051)
Genome map
AA seq 473 aa AA seqDB search
MKGKYRVGLISFSDGREYVHRELEGIVKKFEDEIAKTLEETGEVEVIRAKEIVWKPSIAK
REARRLAEEGAEVTIFNYAVWAFPHFTVLASKFAPGPFLLFSNINPQYPGMVAMLSAAGA
LEQDGTKHYRMWGSIKDEKVLRKVMAFIRAGSTYKKLRGQRYGVFGGRSMGMYTAVPNVD
LWNKIFGVDVEHIDQFEIVRRSQLIPDERARKGRLWIEEKAKAFHYDGKYLTPEKLELQI
KSYHAVREIVEEMELDFVGIKGQLELTEHFVTMDVTEAFLNDPYDWEEEHEPIVCATESD
SDGALTMQIFKLIAKTPVLFADVRHYVEEYDVLDLCNSGNHATYFAARSFDPDENMKKVE
FYPQTFYFPAGGAAVKHIAAPGKVTLGRLTREDGRYRFTVVPGEFVDFGEEKNYEIADSI
QNNWPHAFLKMETPIDEFLAKYSSNHIHGVYGDYVEEIKTFCEIAGIDFVLMK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaaaatacagggtgggactcatcagcttctccgatggaagagagtacgtgcac
agagaacttgaaggcattgtgaaaaagttcgaagatgagatagcaaaaactctggaagaa
acaggagaagtggaggtaatcagagcaaaagaaatcgtgtggaagccttcaatagcgaag
agagaagcaagaaggctcgcagaagagggagcggaagttaccatcttcaactacgcagtt
tgggcgttccctcatttcacagttcttgcgagcaaattcgcaccgggtccgtttctactt
ttttccaacataaacccgcagtatcctggtatggttgcgatgctttctgcggcgggggct
ctggaacaggacggaacgaagcactacaggatgtggggcagcataaaagacgagaaagtt
ctcaggaaagtgatggcattcatcagagcgggaagcacatacaaaaaactcaggggtcag
agatacggtgtgttcggtggaagatcgatgggtatgtacaccgccgttcctaacgtggat
ctgtggaacaagattttcggtgtcgatgtggagcatatagaccagttcgaaatcgttcga
agaagccagctgataccggacgagcgcgcaaggaaaggaaggctctggattgaagagaaa
gcaaaagcgtttcactacgatgggaagtacctcacacccgaaaagctcgaactccagata
aagagctatcatgcggtgagagagatcgtggaggagatggagctggactttgtgggaata
aaaggccagctcgaactcacagaacacttcgtgacgatggatgtgacggaggcgtttctg
aacgatccctacgactgggaagaagagcacgaaccgatcgtgtgcgcgacagagtcagat
tccgatggggcactcacgatgcagatcttcaagctgattgcgaaaacacccgtgctcttt
gcggacgtgagacactacgtggaggagtacgatgtactggatctgtgcaactcaggaaac
cacgcaacgtactttgctgccagatcgttcgatcccgacgagaacatgaagaaagtggag
ttctatccacagacgttctacttccctgcaggtggtgcagcggtgaaacacatagcagca
cccggaaaagtgacacttggaagactcacaagggaagatggaaggtacagattcacagtc
gttcctggagagttcgtggactttggggaggagaaaaactacgagatagcagacagcata
cagaacaactggccgcacgcgtttttgaagatggagacacctatagacgaattcctggcc
aaatattcctccaaccacatccacggcgtctacggagactacgtggaggagatcaaaacc
ttctgtgaaatagccggtatcgattttgtgcttatgaaatga

DBGET integrated database retrieval system