KEGG   Thermotoga sp. RQ2: TRQ2_0739Help
Entry
TRQ2_0739         CDS       T00706                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
trq  Thermotoga sp. RQ2
Pathway
trq00010  Glycolysis / Gluconeogenesis
trq00030  Pentose phosphate pathway
trq00051  Fructose and mannose metabolism
trq00052  Galactose metabolism
trq00680  Methane metabolism
trq01100  Metabolic pathways
trq01110  Biosynthesis of secondary metabolites
trq01120  Microbial metabolism in diverse environments
trq01130  Biosynthesis of antibiotics
trq01200  Carbon metabolism
trq01230  Biosynthesis of amino acids
trq03018  RNA degradation
Module
trq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRQ2_0739
   00030 Pentose phosphate pathway
    TRQ2_0739
   00051 Fructose and mannose metabolism
    TRQ2_0739
   00052 Galactose metabolism
    TRQ2_0739
  Energy metabolism
   00680 Methane metabolism
    TRQ2_0739
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TRQ2_0739
Enzymes [BR:trq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TRQ2_0739
Protein phosphatases and associated proteins [BR:trq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TRQ2_0739
Messenger RNA biogenesis [BR:trq03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TRQ2_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ACB09091
UniProt: B1L9U3
Position
753612..754571
Genome map
AA seq 319 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAVRAVVRYGVRQGLEVIGVRRGYSGLIDGDFVKLEYKDVAGI
TEKGGTILRTSRCEEFKTEEGRELAAKQIKKHGIEGLVVIGGEGSLTGAHLLYEEHKIPV
VGIPATIDNDIGLTDMCIGVDTCLNTVMDAVQKLKDTASSHERAFIVEVMGRHSGYIALM
AGLVTGAEAIIVPEIPVDYSQLADRILEERRRGKINSIIIVAEGAASAYTVARHLEYRIG
YETRITILGHVQRGGSPTAFDRRLALSMGVEAVDALLDGEVDVMIALQGNKLVRVPIMEA
LSTKKTIDKKLYEIAYMLS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagatagcagtacttacaagcggcggagacgcacctggaatgaacgcagctgtg
agagccgtggtcaggtacggtgtcaggcagggactggaagtgatcggagtgagaagaggt
tactcgggtctcatcgacggcgattttgtaaaactcgagtacaaagatgtggcaggaatt
acagaaaagggaggaacaattctgagaacttccagatgtgaggaattcaagacagaagag
ggtagagaactcgctgcgaaacagataaaaaaacatggtatagaaggactcgtcgtcata
ggtggtgaaggaagtctcaccggcgctcatcttctttacgaagaacacaaaatacctgtt
gtcggtataccagcaaccatagacaacgacattgggttgaccgacatgtgcataggcgtg
gacacgtgtttgaacacggtgatggatgctgttcaaaagctcaaggacaccgccagctcg
catgagagagccttcattgtggaagtcatggggaggcattccggctacatcgccctcatg
gcaggactggtgactggtgcagaagccatcatcgtaccagagattccggtggattattca
cagctcgccgatagaattctcgaagaaaggagaagaggaaagatcaacagcataatcata
gtcgctgaaggtgcagcgagcgcttataccgtcgcaagacacctcgaatacaggataggc
tacgaaacaaggattaccatcctcggacacgtacagagaggtggctctccaacggctttc
gacagaagactggcactgagtatgggagttgaagcggtcgatgctcttctggacggagag
gtagacgtgatgatagcgctccaagggaacaagctcgtgagagtccccataatggaagcg
ctctctacgaaaaaaacgatcgacaagaaactctacgaaatagcctatatgctttcatga

DBGET integrated database retrieval system