KEGG   Thermotoga sp. RQ2: TRQ2_0739Help
Entry
TRQ2_0739         CDS       T00706                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
trq  Thermotoga sp. RQ2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TRQ2_0739
   01230 Biosynthesis of amino acids
    TRQ2_0739
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRQ2_0739
   00030 Pentose phosphate pathway
    TRQ2_0739
   00051 Fructose and mannose metabolism
    TRQ2_0739
   00052 Galactose metabolism
    TRQ2_0739
  Energy metabolism
   00680 Methane metabolism
    TRQ2_0739
Enzymes [BR:trq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TRQ2_0739
Protein phosphatases and associated proteins [BR:trq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TRQ2_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
753612..754571
Genome map
AA seq 319 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAVRAVVRYGVRQGLEVIGVRRGYSGLIDGDFVKLEYKDVAGI
TEKGGTILRTSRCEEFKTEEGRELAAKQIKKHGIEGLVVIGGEGSLTGAHLLYEEHKIPV
VGIPATIDNDIGLTDMCIGVDTCLNTVMDAVQKLKDTASSHERAFIVEVMGRHSGYIALM
AGLVTGAEAIIVPEIPVDYSQLADRILEERRRGKINSIIIVAEGAASAYTVARHLEYRIG
YETRITILGHVQRGGSPTAFDRRLALSMGVEAVDALLDGEVDVMIALQGNKLVRVPIMEA
LSTKKTIDKKLYEIAYMLS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagatagcagtacttacaagcggcggagacgcacctggaatgaacgcagctgtg
agagccgtggtcaggtacggtgtcaggcagggactggaagtgatcggagtgagaagaggt
tactcgggtctcatcgacggcgattttgtaaaactcgagtacaaagatgtggcaggaatt
acagaaaagggaggaacaattctgagaacttccagatgtgaggaattcaagacagaagag
ggtagagaactcgctgcgaaacagataaaaaaacatggtatagaaggactcgtcgtcata
ggtggtgaaggaagtctcaccggcgctcatcttctttacgaagaacacaaaatacctgtt
gtcggtataccagcaaccatagacaacgacattgggttgaccgacatgtgcataggcgtg
gacacgtgtttgaacacggtgatggatgctgttcaaaagctcaaggacaccgccagctcg
catgagagagccttcattgtggaagtcatggggaggcattccggctacatcgccctcatg
gcaggactggtgactggtgcagaagccatcatcgtaccagagattccggtggattattca
cagctcgccgatagaattctcgaagaaaggagaagaggaaagatcaacagcataatcata
gtcgctgaaggtgcagcgagcgcttataccgtcgcaagacacctcgaatacaggataggc
tacgaaacaaggattaccatcctcggacacgtacagagaggtggctctccaacggctttc
gacagaagactggcactgagtatgggagttgaagcggtcgatgctcttctggacggagag
gtagacgtgatgatagcgctccaagggaacaagctcgtgagagtccccataatggaagcg
ctctctacgaaaaaaacgatcgacaagaaactctacgaaatagcctatatgctttcatga

DBGET integrated database retrieval system