KEGG   Thermotoga sp. RQ2: TRQ2_0783Help
Entry
TRQ2_0783         CDS       T00706                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
trq  Thermotoga sp. RQ2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:trq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TRQ2_0783 (ruvA)
Enzymes [BR:trq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TRQ2_0783 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
807796..808362
Genome map
AA seq 188 aa AA seqDB search
MIAGISGRVLKKSGNVLLVETKSGVVFEIVCDVQTSEEVEEGGECFLHTFLSVSQDGITL
YGFSNEMKKELFLSLTKVSRLGPKTALKIISNEDAETLVAMIASQDVEGLSKLPGISKKT
AERIVMELKDEFESAGIKDMRIYHESLEALISLGYPEKQAREAVKHVYREGMKTSELIKE
ALKFLSHR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgatagcgggaatctctggaagggttttgaaaaagagtggaaacgttctcctcgtagag
acaaaatctggagtcgtttttgaaatcgtctgcgatgttcaaaccagtgaggaagtggaa
gaaggcggggaatgttttctccacacgtttttgagcgtttcacaggatggcatcaccctc
tacgggttttcaaacgagatgaagaaggaactcttcctttctctcacaaaggtttccagg
cttgggccaaaaacggccttgaagatcatctcgaacgaagatgcggaaacactggtagca
atgatcgcctctcaggacgtggaaggcctttcaaaacttcccggcatcagtaagaaaaca
gcggaacggatcgtgatggaactgaaagatgaattcgaaagtgctggaataaaagacatg
aggatctatcatgaatccttagaggccctgatatcactgggatacccggagaaacaggca
agagaagcggtgaaacacgtgtacagagagggaatgaaaacatccgagttgataaaagaa
gctttaaagtttctgagtcacagatag

DBGET integrated database retrieval system