KEGG   Thermotoga sp. RQ2: TRQ2_0808Help
Entry
TRQ2_0808         CDS       T00706                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
trq  Thermotoga sp. RQ2
Pathway
trq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
trq01100  Metabolic pathways
trq01110  Biosynthesis of secondary metabolites
trq01130  Biosynthesis of antibiotics
trq01230  Biosynthesis of amino acids
Module
trq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TRQ2_0808
Enzymes [BR:trq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     TRQ2_0808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS DUF1877 DUF4962
Motif
Other DBs
NCBI-ProteinID: ACB09160
UniProt: A0A0F6AKW9
Position
833208..833900
Genome map
AA seq 230 aa AA seqDB search
MIVQRRNHRFLEVLSGKEKVKIIAEFKKASPSAGDINADASLEYFIRMYDELVDAISILT
EKHYFKGDISFVKAARALTCRPILAKDFYIDKVQVKLASSVGADAVLIIARILTAEQIKE
IYEAAEELGMDSLVEVHSREDLEKVFSVIRPKIIGINTRDLDTFEIRKNVLWELLPLVPD
DTVVVAESGIKDPRELKDLRGKVNAVLVGTSIMKAENPRRFLEEMRAWSE
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgttcaaagaagaaaccacagatttctggaggttctgtcgggaaaagagaaagta
aagatcatagcggaattcaagaaggcttctccatctgctggagatataaacgctgatgct
tctctggaatatttcataaggatgtacgacgagctggtggatgcgatcagcatcctcacg
gaaaagcattatttcaaaggagatatttctttcgtaaaagcagcgagggccttgacctgc
agacccattctcgctaaggacttctacatagacaaggtccaggtgaaactggcttccagt
gtgggagcagacgccgttcttattatcgcccgaatactcactgcagagcagataaaagag
atctatgaagcggcggaagagctcggaatggacagtctcgtagaagtccactccagagaa
gatctggagaaggtcttttcggtgatcagaccgaagataatcggtatcaacacgagagat
ctggacactttcgagataaggaagaatgtgctgtgggaacttctaccactcgtgccggat
gatacggttgtggtcgctgaaagtggcataaaagatcccagagaactcaaggatctgcgg
gggaaggtgaacgctgttctcgttggtacatccatcatgaaagccgagaatccaagaaga
tttctggaagagatgagagcatggtcagagtga

DBGET integrated database retrieval system