KEGG   Thermotoga sp. RQ2: TRQ2_0811Help
Entry
TRQ2_0811         CDS       T00706                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
trq  Thermotoga sp. RQ2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TRQ2_0811
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TRQ2_0811
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TRQ2_0811
Enzymes [BR:trq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TRQ2_0811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
835674..836393
Genome map
AA seq 239 aa AA seqDB search
MKGFIAYIPAGFPDLETTRKILIALNELGITGVEIGVPFSDPVADGPVIQLAHSVALRNG
VTMKKILEMLGEISVDYDLYLMSYLNPIVNYPEGKEKLLDELKKLGVKGLIIPDLPLREV
KNVNIAYPIVPFVAPNTKDEEIEFINSVQAPFVYYISRYGVTGEREDLPFADHIKRVKER
IKLPLFVGFGISRHEQVEKVWEIADGAIVGSALVRIMEESPKDEIPKKVVEKVKELLGK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaagggctttattgcatacatccccgctggatttcccgatcttgaaaccacaaggaaa
atacttatcgctctcaacgaactcggcatcacaggtgtggagataggagttccgttctcc
gatccggtggctgacggtcctgttattcagcttgcccacagcgtggctctgagaaatgga
gtcactatgaagaagatcctggagatgctgggtgaaatatctgttgattacgatctctac
ctgatgagttatctgaatccgatagtgaactatccagagggaaaagaaaaactcctcgat
gaattgaaaaaactcggtgtgaagggcttgatcatacctgacctgcccttgagggaggta
aagaacgtcaatatagcgtatcccatagttcccttcgttgcaccgaacaccaaagatgag
gaaatagagtttatcaattccgttcaggctccgttcgtctattacatatcccggtacggc
gtcacaggtgagagggaagaccttcctttcgcggatcacataaagagggtgaaagaaaga
ataaaacttcctctcttcgtgggttttggaatctccaggcacgaacaggtggagaaggtg
tgggagatcgccgacggtgcgatcgtcgggagcgcgcttgtgagaataatggaagaaagt
ccgaaggatgagattcctaagaaggttgttgagaaagtgaaagaactcctcggaaaataa

DBGET integrated database retrieval system