KEGG   Thermotoga sp. RQ2: TRQ2_0836Help
Entry
TRQ2_0836         CDS       T00706                                 

Definition
(RefSeq) iron-containing alcohol dehydrogenase
  KO
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
trq  Thermotoga sp. RQ2
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    TRQ2_0836
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRQ2_0836
  Lipid metabolism
   00071 Fatty acid degradation
    TRQ2_0836
  Amino acid metabolism
   00350 Tyrosine metabolism
    TRQ2_0836
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TRQ2_0836
   00626 Naphthalene degradation
    TRQ2_0836
Enzymes [BR:trq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TRQ2_0836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(860007..861170)
Genome map
AA seq 387 aa AA seqDB search
MFKISSYLPTEIIFRVGAVDELEERAKKLGKKALIVTGRSSTKKTGLLQRVVDLLKKAGV
ESFVFDKIIPNPISDHVDEAAEIVRKEKIDFIIGLGGGSPIDSAKAISITAPNEGKFWDY
VPVGGGKIPEKSIPVVAIPTTHGTGTEADPFAVITNPQTKEKVGIGYRNTFPVLSLVDPE
VMKTLPKDQTAYTSMDAFYHAIEAFLNVNANPYSDVLALDAMKRIVTYLPVAYENGEDME
ARTNLAWASTEAGITETLTGVIANHALEHGLSGFYPEITHGLGLCITGPYLFEYIFDHAY
ERLAIVGREVFGVYETDDRKAGRIAIKKLRDFQEMFGLNKRLSELGVKKEDIPKMAETGY
RILNGVVVVTPGNLTAKDMEEIFNRCY
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaatttcatcctatcttccaacggagatcattttcagggtgggagcggtggac
gaactggaagaaagggcaaaaaagctcggaaaaaaagcattgattgtgacagggcgctcc
agcactaagaagaccggccttttgcagagagtggtagatcttctcaagaaagcaggagtg
gaaagtttcgtcttcgacaaaataattcccaacccgatatcggatcacgtcgatgaggct
gcagaaatcgtgagaaaagagaaaatagatttcatcataggacttggtggaggaagtcca
atagacagcgcaaaagcgatttctattaccgctccgaatgaaggaaaattctgggattac
gttcccgtaggtggtggaaagattccagaaaaatccatccccgttgttgctatacccacc
acacacggaacgggaaccgaggcagatccatttgcggtgatcacaaatccccaaacgaaa
gaaaaagtgggaataggctatagaaacacctttcccgttctctcccttgtggatcctgaa
gtgatgaagacattaccgaaagaccagaccgcgtacacctctatggatgcgttctatcac
gctatagaagccttcctcaacgtgaatgcgaatccttactcggatgtcctcgccctggac
gccatgaaaaggattgtgacatatctcccagttgcttacgagaacggagaagatatggaa
gccagaacgaacctcgcctgggccagtactgaagcaggaatcacagagactctgaccggt
gtgatcgcaaaccacgcgctggagcatggtctcagtggtttctatccagaaatcacccat
ggtcttggtctgtgcatcacaggtccgtacctgttcgaatacatcttcgatcacgcctac
gagagactcgccatcgttggaagggaagtgttcggcgtttacgaaacagacgatagaaaa
gctggaaggatcgctatcaagaaactgagagacttccaggaaatgttcggtctcaacaag
agactcagtgaactgggtgtgaaaaaagaggatattccaaagatggcagaaaccggctac
aggatactgaatggagtggttgttgtaactcccggtaacttaaccgcgaaggacatggaa
gaaatattcaacaggtgttactga

DBGET integrated database retrieval system