KEGG   Thermotoga sp. RQ2: TRQ2_0877Help
Entry
TRQ2_0877         CDS       T00706                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
trq  Thermotoga sp. RQ2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
906098..907141
Genome map
AA seq 347 aa AA seqDB search
MKILPSVLILLLGCVPVFSSQNVSLRELAEKLNIYVGFAAINNFWSLSDAEKYMEVARRE
FNILTPENQMKWDTIHPERDRYNFTPAEKHVEFAEENNMIVHGHTLVWHNQLPGWITGRE
WTKEELLNVLEDHIKTVVSHFKGRVKIWDVVNEAVSDSGTYRESIWYKTIGPEYIEKAFR
WAKEADPDAILIYNDYSIEEINAKSNFVYNMIKELKEKGVPVDGIGFQMHIDYRGLNYDS
FRRNLERFAKLGLQIYITEMDVRIPLSGSEEYYLKKQAEVCAKIFDICLDNPAVKAIQFW
GFTDKYSWVPGFFKGYGKALLFDENYNPKPCYYAIKEVLEKKIEERK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattaccttctgtgctgatccttttgttgggatgtgttccggttttcagctct
caaaatgtatctctgagagagctcgcagaaaagctgaacatctatgtcggttttgccgca
atcaacaacttttggtctctttccgacgcagaaaagtacatggaagttgcaagaagagaa
ttcaacatcctgactcccgagaaccagatgaagtgggatacgatccatccagaaagagac
agatacaatttcactcccgctgaaaaacacgttgagtttgcagaagaaaacaacatgatc
gtgcatgggcacactcttgtctggcacaaccagcttcctggatggatcactggtagggaa
tggacaaaggaagaacttttgaacgttcttgaagaccacataaaaacggtggtgtctcat
ttcaaaggtagagtgaagatctgggatgtggtgaacgaagcggtgagcgactctggaaca
tacagagaaagtatctggtacaagacgatcggtcctgaatacattgaaaaagcgttcaga
tgggcaaaagaagccgatccagatgcgattctcatctacaacgactacagcatagaagaa
atcaacgcaaaatcgaacttcgtctacaacatgataaaagagctgaaagaaaagggagta
cctgtagatggaataggatttcagatgcacatagactacagagggctcaattatgacagt
ttcagaaggaatttggagagatttgcgaaactcggtcttcaaatatacatcacagagatg
gatgtgagaattcctctcagtggttcggaggagtattatttgaaaaaacaggctgaagtt
tgtgcgaagatcttcgatatatgcttggacaaccctgcagttaaagcgatccagttttgg
ggattcacagacaaatactcctgggttcccggctttttcaaagggtacggaaaagcgttg
ctattcgacgagaattacaatcccaagccttgttattacgcgataaaagaggtgctggag
aaaaagatagaagaaagaaaatga

DBGET integrated database retrieval system