KEGG   Thermotoga sp. RQ2: TRQ2_1163Help
Entry
TRQ2_1163         CDS       T00706                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
trq  Thermotoga sp. RQ2
Pathway
trq00300  Lysine biosynthesis
trq01100  Metabolic pathways
trq01120  Microbial metabolism in diverse environments
trq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TRQ2_1163
Enzymes [BR:trq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     TRQ2_1163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ACB09507
UniProt: A0A0F6ALR9
Position
1201964..1203154
Genome map
AA seq 396 aa AA seqDB search
MEITKRIEELGEEMVESLKKFISINSVNPAFGGPGEKEKADWLEGLLRDFGFEVERYDVK
DDRGIWRSNVVAKIPGRNREKTLWIVTHIDTVPPGDLSLWETDPFVPVVKDGKVYGRGAE
DNGGSMIASIYAGKVLIDLGITPEYNFGLALVADEEAGSGYGIQYLIEKGLFSPEDMFLV
PDAGNEKGDFIEIAEKSILWFKVTVNGKQGHASRPRTTENALRKGAYLIAEIDEALHRKY
SDIDELFDEPLSTFEPTRAEKTVDNVNTVPGRFVFYFDCRVLPRYDLNEVLSTIESILDG
RGAELEVVVKQPAPKPTPPDSELVVKLSDVLRSLRGLEAKVGGIGGGTCAAFFRKKGWPA
VVWSTIDGTAHQPNEYRRISHMVEDAKVFALLGTER
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggagatcacaaaaagaatagaagaactcggagaagaaatggtggagtccctgaaaaaa
ttcatctccatcaattcggtgaatcccgcctttggaggcccaggagagaaagaaaaggcc
gactggctcgaaggtctcctcagggatttcggtttcgaggtcgaacgctacgatgtgaaa
gacgataggggcatatggcgatcgaacgttgtagcaaagattccaggaagaaacagagaa
aaaacgctttggatcgtgactcacatcgataccgtaccaccgggagatctctctttgtgg
gagacggatcctttcgtgcccgttgtgaaagacgggaaggtttacggtaggggagccgaa
gacaacggaggttccatgatagcctccatatacgctgggaaggtcctcatcgaccttggt
atcactcctgagtacaacttcggtcttgcgctcgtcgccgacgaggaggcaggaagcgga
tatggaatccaatatctgatagaaaaagggttgttcagcccagaagacatgttcctggtc
ccggatgccggaaacgaaaagggagacttcatcgagatcgcagagaagagtatcctgtgg
ttcaaagtgacggtgaacggaaaacagggacacgcttcaagaccgaggacaacggagaac
gctctcagaaaaggtgcgtatctcatagcggagatagatgaagcgcttcacaggaaatac
tccgatatagacgaactcttcgatgaaccgctcagcacgttcgaacccactcgagctgaa
aaaactgtggacaacgtgaacaccgttcccggcaggttcgttttttactttgactgcagg
gttctgccccgctacgatctcaacgaagtgctgtccaccatcgagtcgattctagacgga
agaggtgcagagctggaggtcgttgtgaaacagcccgcacccaagccaactccacccgat
tcggaactcgtggtgaaactttccgatgttttgagaagtctaagagggctggaagcgaaa
gtgggaggtataggtggaggcacctgcgccgcgttcttcagaaagaaaggctggcccgct
gtcgtctggagcacaatagacgggactgctcatcagcccaacgagtaccgaagaatatcg
cacatggtggaagatgcgaaggtgttcgcacttctcggaactgagaggtga

DBGET integrated database retrieval system