KEGG   Thermotoga sp. RQ2: TRQ2_1305Help
Entry
TRQ2_1305         CDS       T00706                                 

Definition
dihydrofolate reductase-like protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
trq  Thermotoga sp. RQ2
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TRQ2_1305
   00670 One carbon pool by folate
    TRQ2_1305
Enzymes [BR:trq01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     TRQ2_1305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1333484..1333993
Genome map
AA seq 169 aa AA seqDB search
MAKVIFVLAMDVSGKIASSVEGWNSFEDRKNFREITTEIGNVVMGRVTFEEIGRPLPERL
NVVLTRRRRSSDDPSLVFFNGSPGDVVKFLEGKGYERVAVIGGKTVFTEFLREKLVDELF
VTVEPYVFGKGIPFFDEFEGYFPLKLLEMRRLNERGTLFLKYSVEKSHR
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaagtgattttcgttcttgcgatggacgtctccggaaagatagcctcctctgtt
gaaggctggaactcatttgaggacagaaaaaatttcagagagatcaccacggagatcgga
aacgttgtgatgggaagggtcaccttcgaggaaataggaagacctcttccagagaggctg
aacgttgttttgacgagaagacgcaggtcttccgatgatccttcacttgtttttttcaac
ggttcacctggggatgtggtaaaattcctcgaaggaaaaggctacgaaagggtggctgtc
ataggaggaaagaccgtgttcacggaatttctgagagaaaaactggtagatgagcttttc
gtcaccgtcgaaccgtacgtgttcggaaagggaatacctttcttcgatgaattcgaaggt
tactttcctttgaaacttctggagatgaggcgtttgaacgaaagaggcacactttttctc
aaatattctgtagaaaaatcgcaccgttag

DBGET integrated database retrieval system