KEGG   Thermotoga sp. RQ2: TRQ2_1306Help
Entry
TRQ2_1306         CDS       T00706                                 

Gene name
pyrB
Definition
bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit
Orthology
K00608  
aspartate carbamoyltransferase [EC:2.1.3.2]
Organism
trq  Thermotoga sp. RQ2
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TRQ2_1306 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TRQ2_1306 (pyrB)
Enzymes [BR:trq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     TRQ2_1306 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1334029..1335612
Genome map
AA seq 527 aa AA seqDB search
MKRDFLGRTLAVIEDLSVEEQMFLYEKTRELKQRWYSGEDVSDFRIKKRNVGIYIVFVEP
STRTKESFINAAKFHSGPNVKVNVFDSEHSSFNKQESYTDTFSMLTGYSDYSIFVVRTRL
EGVCRLLERRISEFASRNGIEVPSFINAGDGKHEHPTQELLDEYTFLEQNGFDNSFIHVA
LVGDLLHGRTVHSKVNGLKIFKNVKVDLVAPEELMMPEHYVEKMKKNGFEVRIFSSIREY
LSQKDVAKIWYFTRLQLERMGEDILEKVHILREAVTFKKEYLDALPEGVKFYHPLPRHKV
YPTIPNFLDTLPLNGWETQARNGYWVRIVLLSMFGGALEAPFDTSKKEEKPEEDFIIPAP
ITHGSKGVQKEGKRGIKPIENGTVIDHIAKGKTPEEIYSTIVKIRKILRLYDVDSADGIF
RSSDGNFKGYISLPDRYLSKREIKKLSAISPNTTVNIIKNSTVVEKYRIKLPPTIYGFEE
LRCKNENCITNPAHGENASPSFVRNEKGQFICEYCETPHSFEEIWSI
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggattttctcggcagaaccctcgcagtcatagaagatctgagcgtggaggag
cagatgttcctctatgagaaaaccagggagctcaaacagagatggtacagcggagaggat
gtatcggatttcaggataaagaagagaaacgttggaatatacatcgttttcgtcgaacca
agcacgaggacgaaagaatctttcataaacgctgcgaagtttcactcaggcccgaacgtg
aaggtgaacgttttcgattcggaacattcctccttcaacaaacaagagagctacacggat
actttctccatgctcacaggctacagcgactactccatattcgttgtgagaacaagactc
gaaggagtctgcagactcctagaaagaagaatatcagaattcgcaagcaggaacggtata
gaagtaccctcttttataaacgcgggcgacggaaagcacgagcatccaacacaggaactt
ctggatgaatacacctttctcgagcagaacggtttcgacaactcgttcatacacgtggca
ctcgttggtgacctgcttcacggccgaacggttcactccaaggtgaacggcttgaagata
ttcaaaaatgtgaaggtggatcttgtggcaccggaagagctcatgatgcctgagcattac
gtagagaagatgaaaaagaacggtttcgaggtcaggattttctcttcgatcagagagtat
ctcagccagaaagatgtggcaaagatctggtactttacacgactccagctcgaaagaatg
ggagaagacatcctcgagaaggttcatattctgagagaagcagtcacgttcaaaaaagag
tatctggacgcactgccggaaggagtgaagttctatcatccgcttccaaggcacaaggtt
tatccgacgataccgaactttctggacacacttcctctgaacggatgggaaacacaggca
aggaacggttactgggtgaggatcgtgcttctttccatgttcggtggagcgctggaagca
cctttcgatacctcgaagaaagaagaaaaaccagaagaagacttcataattcccgctccc
atcacacacggatcaaagggggttcaaaaggaaggaaaaagaggtataaaacccattgaa
aacggaacggtgatagaccacatagccaaaggaaagacaccggaggaaatttactcaaca
attgtgaaaataaggaaaattctgagactctacgatgtggacagtgcggatggtattttc
cggtcgagcgatggaaacttcaagggttacatcagcctgccggatcgctatctctccaaa
agagaaataaagaaactctcggcgatttctccaaacaccacagtcaacatcataaaaaac
agcacggttgttgaaaagtacagaataaaacttccaccaacgatctatggattcgaagaa
ctccgatgtaaaaatgaaaactgcatcaccaatcccgcacacggcgaaaacgcttcacct
tcctttgtgagaaacgaaaaaggacagttcatatgcgagtactgtgaaacaccgcattct
ttcgaagagatctggagtatttga

DBGET integrated database retrieval system