KEGG   Thermotoga sp. RQ2: TRQ2_1322Help
Entry
TRQ2_1322         CDS       T00706                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
trq  Thermotoga sp. RQ2
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    TRQ2_1322
Enzymes [BR:trq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     TRQ2_1322
Exosome [BR:trq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TRQ2_1322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1353276..1354766
Genome map
AA seq 496 aa AA seqDB search
MKYVLSLDQGTTSSRAIVFDEKGNVISKVNKEFKQIYPRPGWVEHDPMEIWESQIEVAER
AIEEAGIKPEEIAAIGITNQRETTIVWDKNTGKPVYNAIVWQCRRTAPICDELKEKGYAE
FIRERTGLVIDAYFSGTKIKWILDNVEGVREKAEKGEVLFGTVDTWLIWNLTGGKVHVTD
YSNASRTMIFNIHKLDWDDEILELLNIPRAMLPQVMPSSHVYGYTAKDIFGVEIPIAGDA
GDQQAALFGQACFQPGMLKNTYGTGCFLLMNTGEKAFESKSGLLTTIAWGINGKVYYALE
GSIFITGAAVQWLRDGLRIISNAAETEELATKVPDNGGVYFVPAFVGLGAPYWDMYARGL
IIGITRGTTREHIVRAVLESIAYQTRDVVEVMEKDSDIKVETLRVDGGAVVNNFLMQFQA
DILGIPVERPVVNETTALGAAYLAGLAVGYWKDQEEIASLWQLDRRFEPSMNSEERERLY
SKWKEAVSRSLGWEKR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatacgttctttctctcgatcagggtacaacgagttccagggcgatcgtcttcgac
gagaagggaaacgtgatctccaaggtcaacaaagagttcaaacagatctatccaaggccc
gggtgggtggaacacgatccgatggagatctgggagtctcagatcgaagttgcagaaagg
gcgatcgaagaagcaggaatcaagcctgaagagatagccgccatagggatcacaaaccag
agggaaacaaccatcgtctgggacaaaaacacgggaaaacccgtctacaacgccatcgtg
tggcaatgcagaagaacggctcccatatgcgatgagttgaaagaaaagggctacgctgag
ttcatccgcgaaagaacggggctcgtcatcgacgcgtatttttccggaacgaagatcaag
tggatcctcgacaacgttgaaggagtgagggaaaaagcagaaaagggagaggtgctcttt
ggaacggtcgacacctggctcatctggaacctcacgggcgggaaagtacacgtcaccgat
tattcgaacgcttccagaactatgatcttcaacatccacaaactcgactgggacgatgaa
atactggaacttctaaacataccgagggcgatgcttccacaggtgatgccgtcgagtcac
gtgtacggttacacagcaaaggatatcttcggagtggaaatacctatagctggagacgca
ggggatcaacaggcggcactgtttgggcaagcctgcttccagccaggcatgttgaaaaac
acttacggaacaggatgtttcctcctcatgaacaccggagagaaagcatttgaatcaaaa
tccggtcttctcacaaccatcgcgtggggaataaacgggaaggtttactatgcccttgaa
ggcagcatatttattactggcgccgctgtgcaatggctaagggatggtctgaggatcatc
tcaaacgccgcagaaaccgaagaactcgccacaaaagtgccagacaacggaggtgtgtac
tttgttccggcgttcgtggggcttggtgcaccgtattgggacatgtacgctcgaggcttg
atcataggcataaccagaggtaccaccagagagcatatagtgagggccgttcttgagtcg
atcgcctatcagacaagagatgtggtagaagtcatggaaaaagacagcgatataaaggtg
gaaaccctccgggtcgatggtggagccgttgtgaacaactttctgatgcagtttcaggct
gatatccttggaatccctgtggaaagacctgttgtgaacgaaacaacagcccttggagct
gcttaccttgcaggactcgcggttgggtactggaaagatcaagaagagatagcttctctc
tggcaactcgacagaagatttgaaccctctatgaattccgaggaaagagagaggctgtat
tcaaaatggaaagaggcagtgtcgagatcccttggatgggaaaaacgatga

DBGET integrated database retrieval system