KEGG   Thermotoga sp. RQ2: TRQ2_1363Help
Entry
TRQ2_1363         CDS       T00706                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
trq  Thermotoga sp. RQ2
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TRQ2_1363
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRQ2_1363
   00052 Galactose metabolism
    TRQ2_1363
   00500 Starch and sucrose metabolism
    TRQ2_1363
   00520 Amino sugar and nucleotide sugar metabolism
    TRQ2_1363
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TRQ2_1363
   00524 Butirosin and neomycin biosynthesis
    TRQ2_1363
Enzymes [BR:trq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TRQ2_1363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1388459..1389403)
Genome map
AA seq 314 aa AA seqDB search
MKLIGVDLGGTTFSVGLVSEDGKILKKVTRDTLVENGKEDVIRRIAEAILEVADGEETPY
VGIGSPGSIDRENGIVRFSPNFPDWHNVPLTDELAKRTGKKVFLENDANAFVLGEKWFGA
GRGYDHIVALTLGTGIGGGVVTHGHLLTGRDGIGAELGHVVVEPNGPMCNCGTRGCLEAV
SSATAIRRFLREGYKKYHDSLVYKLAGSPEKADAKHLFDAARQGDRFALMIRDRVVDALA
RAVAGYIHIFNPEIVIIGGGISRAGEILFGPLREKVVDYIMPSFVGTYEIVASPLVEDAG
ILGAASIIKERIGG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctcataggagttgatcttggaggaactaccttctcggtaggactcgtgagtgaa
gatggaaaaatactgaagaaagtaactcgggatactctcgtagagaacggaaaagaagat
gtgataagaagaatcgccgaagcgattctggaggtggctgatggagaagaaacgccttac
gttggcattggatctccaggttcgatagatagagagaatgggattgtcagattctcccct
aattttccggactggcacaacgttccactaactgatgagctggcaaagagaactgggaag
aaagtttttcttgaaaacgatgcgaacgcgtttgtccttggagagaagtggttcggagcc
ggaagaggatacgatcacatagtggctctgacacttggaactggcattggcggaggagtt
gtcactcacggacacctcctcacgggaagggatggaataggagcggaactcgggcatgtt
gtcgtcgaacccaatggccccatgtgcaactgcggtacaaggggttgtcttgaagctgtg
tcatccgcaacggcgataaggagatttctcagagaaggctacaagaaatatcacgactct
ctggtttacaaactcgcgggttcacccgaaaaggcagacgccaagcacctttttgacgcc
gcaagacagggagacagattcgctctgatgataagagacagggtggtggatgccctggca
cgagccgtagcgggctacatacacatattcaacccggagatagtgatcataggtggagga
atttcaagagcgggagagattctgtttggtcccctgagagagaaagtggtggattacatc
atgccatcctttgtgggaacctacgaaatagtggcgagccctctcgtcgaagacgccgga
atcctcggagcggcttccataataaaggagaggataggggggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system