KEGG   Thermotoga sp. RQ2: TRQ2_1623Help
Entry
TRQ2_1623         CDS       T00706                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
trq  Thermotoga sp. RQ2
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:trq00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1640344..1642293
Genome map
AA seq 649 aa AA seqDB search
MLGVCYYPEHWGIERVEEDFRRMKELGIEYVRIGEFAWSRIEPERGKFNWDWLDKTLELA
EKMGLKIVLGTPTATPPKWLIDEHPEILPVDKDGRVKNFGSRRHYCFSSPVYREEVKRIV
TIIAKRYGKHPAVAGWQTDNEYGCHDTVKCYCPRCKKAFQKWLERKYEGDIKKLNEAWGT
VFWSQEYRSFDEIELPNLTPADPNPSHLLDYYRFASDQVVEFNKLQVEIIREYSPGRFIT
HNFMGGFVDFDHYKLSRDLDFASWDNYPLGHTLVFLRMKGETKNPFDRVGHPDIISFSHD
LYRGVGRGRFWVMEQQAGPVNWAPYNLWPAKGAVKLWTWQAFAHGAEVVSYFRWRQVPFA
QEQMHSGLLAPDSAPSPGYHEVKQVFEELKNIDINEPVKSEVALVFDYETAWIFSIQPHG
EGANYLDLVFRCYSALRSLGLNVDIVPPGSSLDGYKMVVVPSLAIVKEEVLNTFKKYDGL
LVLGPRSGSKTETFQIPPEMPPGLLKELIPVEVRQVESLGYNAETLIWNGKEYPVLIWRE
DVDPTITEVIARFKDGFGAIFRKDNVFYLSFWPDREFLVDFFEALSKESGIETKRLPEGI
RIQRRGEYVFSFNFTSEEVDLEIPAKVQIVLGDQKIPPYGLLIWRENEH
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgctcggagtctgttactatcctgaacactggggaatagagagagtggaagaagacttc
agaaggatgaaagaactcgggatagagtacgtgaggattggagagttcgcctggagcagg
atagagcctgagcgtggaaagttcaactgggactggctcgacaaaacacttgagctggca
gagaagatggggctcaagatcgtactgggaactcccacagctacacctccgaagtggctc
atcgatgaacacccggagatccttcccgttgataaagatggcagggtgaaaaattttggt
tccagaagacattactgcttctccagccctgtctatagagaagaagtgaaaagaatcgtc
accataatagcgaaaaggtacggaaaacacccggcagtcgcaggctggcagacggacaac
gaatacggctgtcacgatacggttaagtgctactgtccgaggtgcaaaaaagccttccaa
aaatggttggaaagaaagtacgagggagacataaagaaattgaatgaagcgtggggaaca
gtgttctggagccaggagtatcgatccttcgacgaaatagagcttccgaatctcactcct
gccgatccaaacccgtctcatcttctcgactattacaggttcgcttccgaccaggtggtg
gaattcaacaagcttcaagtggagatcataagggagtattctcctggaagattcatcaca
cacaatttcatgggaggatttgtagattttgaccattacaaactttcaagagacttggat
tttgcatcctgggacaactacccactcggacacacactcgtttttctgagaatgaagggt
gagacgaaaaatccgttcgatagagtaggacacccggacatcatctccttctcacacgac
ctgtaccgaggagtgggcaggggaagattctgggtgatggaacagcaagcaggacctgtg
aactgggctccttacaatctctggcctgccaaaggagcagtgaaactctggacgtggcag
gcattcgcacacggtgcggaggtggtctcttacttcagatggaggcaggttcctttcgcg
caggagcagatgcactccggacttctggcaccggattcagcaccttcccctggataccat
gaggtaaagcaggttttcgaggagctcaaaaacatcgatatcaatgaacccgtgaaaagc
gaagtggcacttgtcttcgattatgaaacagcatggatcttctccatacaaccgcacggc
gagggggcgaactacctcgatcttgtcttcagatgctacagcgcgctcagaagtcttggt
ctgaacgtggatatagtaccccctggatcttcactggacggatacaaaatggtcgttgtt
ccaagtcttgccattgtgaaggaagaggttctgaacacgtttaaaaaatacgacggtctt
ctcgtacttggcccaagaagcggaagcaaaacagagacgttccagattcctcccgagatg
cccccaggtcttctcaaagagctcatacccgttgaagtaagacaagttgaaagccttggg
tacaacgctgaaactcttatttggaacgggaaagagtatcccgtcttgatctggagggag
gacgtggatcctactatcacggaagtgatcgcaagattcaaagatggttttggagccata
ttccggaaagacaacgttttttacctttctttctggcctgacagagaatttcttgtagat
ttctttgaagcactttcaaaagaatcaggaattgaaacgaaaagattaccagaaggaata
cgcattcaaaggagaggtgaatatgttttttctttcaatttcacctctgaggaggtagat
ttagaaataccagcaaaggttcagatagttctaggagatcaaaagattcctccctacgga
ctgttgatatggagggaaaacgaacactga

DBGET integrated database retrieval system