KEGG   Thermotoga sp. RQ2: TRQ2_1625Help
Entry
TRQ2_1625         CDS       T00706                                 

Definition
glycoside hydrolase family 42 protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
trq  Thermotoga sp. RQ2
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TRQ2_1625
  Lipid metabolism
   00600 Sphingolipid metabolism
    TRQ2_1625
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TRQ2_1625
Enzymes [BR:trq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     TRQ2_1625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1643294..1646548
Genome map
AA seq 1084 aa AA seqDB search
MSYEWENPQLVGEGTEKPHASFIPYLDPFSGEWEYPEEFISLNGNWGFLFAKNPFEVPED
FFSENFDDSNWDEIEVPSNWEMKGYGKPIYTNVVYPFEPNPPFVPKDDNPTGVYRRWIEI
PEDWFKREIFLHFEGVRSFFYLWVNGKKIGFSKDSCTPAEFRLTDVLRPGKNLITVEVLK
WSDGSYLEDQDMWWFAGIYRDVYLYSLPKFHIRDVFVRTDLDENYRDGKIFLDVEMRNLG
EEEEKDLEVTLITPDGDEKTLVKETVKPEDRVLSFAFDVKDPRKWSAETPHLYVLKLKLG
EDEKKVNFGFRKIEIKDGMLLFNGKPLYIKGVNRHEFDPDRGHAVTVERMIQDIKLMKQH
NINTVRTSHYPNQTKWYDLCDYFGLYVIDEANIESHGIGEAPEVTLANRPEWEKAHLDRI
KRMVERDKNHPSIILWSLGNEAGDGVNFEKAALWIKKRDNTRLIHYEGTTRRGESYYVDV
FSLMYPKMDVLLEYASKKREKPFIMCEYAHAMGNSVGNLKDYWDVIEKYPYLHGGCIWDW
VDQGIRKKYENGREFWAYGGDFGDTPNDGNFCINGVVLPDRTPEPELYEVKKVYQNVKIR
QVSKDTYEVENRYLFTNLEMFDGAWKIRKDGEVIEEKTFKIFAEPGEKRLLKIPLPEMDD
SEYFLEISFSLSEDTPWAEKGHVVAWEQFLLKAPAFEKKSISDGVSLREEGKHLTVEAKD
TVYVFSKLTGLLEQILHRGKKILKSPVVPNFWRAPTDNDIGNRMPQRLAIWKRASKERKL
FKMHWKKEENRVSVHSVFQLPGNSWVYTTYTVFGNGDILVDLSLILAEDVPEIPRIGLQF
TVPEEFGTVEWYGRGPHETYWDRKESGLFARHRKAVDEMIHRYVRPQETGNRSDVRWFAL
SDGETKLFVSGMPQIDFSVWPFSMEDLERAQHISELPERDFVTVNVDFRQMGLGGDDSWG
AMPHLEYRLLPKPYRFSFRMRISKEIPSWRVLAAIPETLHVEMSSEDVIREGDTLRVKFS
LLNDTPLSKEEQVVLFVDGNEYSVRRVVIPPFKKEELVFKVEGLKKGEHLIHTNLNTRKT
IYVR
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacgaatgggaaaacccacagcttgtgggtgaaggaacggagaagccacacgct
tctttcataccctatctggacccgttcagcggggaatgggagtaccctgaggaattcatc
tctttgaacgggaactgggggtttctcttcgcgaaaaatcccttcgaggtgccggaggat
ttcttttcagagaacttcgacgactcgaactgggatgagatagaagttccaagcaactgg
gagatgaaaggatatgggaagcccatctacacgaacgtggtttatccatttgaaccgaac
cctccttttgttccaaaagacgacaatccgaccggggtgtacagaaggtggatcgagata
cctgaggattggttcaaaagggagatctttctgcattttgaaggtgttcgatccttcttc
tatctgtgggtgaacgggaagaagatcggtttcagcaaagacagctgcacacccgctgaa
ttcagactcaccgatgttctaaggccagggaagaatctgatcaccgttgaggttctgaag
tggagcgatggaagctatctcgaagatcaggacatgtggtggtttgcggggatatacagg
gacgtttatctgtactcgctgccgaaatttcacatcagggacgtgttcgtgagaacggat
ctggatgaaaattacagagacggaaagatctttctggacgtagagatgagaaatctcggt
gaggaagaagaaaaagaccttgaagtaacactcatcacaccggatggagacgaaaaaaca
ctcgtgaaagagacagtaaagccggaggacagagtcctttcctttgcctttgacgtgaaa
gatccgaggaagtggtccgcggagacaccacatctgtacgttttgaaactgaaactggga
gaagacgaaaagaaagtcaacttcggattcaggaagatagagataaaagacggaatgctt
cttttcaacgggaaacctctctacataaagggagtgaacagacacgagttcgaccccgac
aggggtcatgcggtgacagtggagagaatgattcaggacataaagctaatgaagcagcac
aacataaacacagttcgcacatcacactatccgaaccagacgaagtggtacgatctgtgt
gactattttggactctacgtgatagacgaggcaaacatcgaatctcatggaatcggtgaa
gctcctgaagtgacccttgcgaacagaccggaatgggagaaggcacatctcgacaggatc
aaaaggatggtcgagcgcgacaagaatcatcccagtatcatcctctggtctctcgggaac
gaagcgggagatggagtgaatttcgaaaaagccgctctctggataaagaaaagggacaac
acgcgacttatccattacgagggaacaacaaggaggggagaatcgtactacgtcgatgtt
ttctccctcatgtatccgaagatggacgttcttcttgagtacgcttcaaagaagagggaa
aagcccttcatcatgtgtgaatacgcgcacgcgatgggaaacagtgtgggaaatctgaag
gactactgggacgtgatagaaaagtatccgtaccttcatggaggttgcatctgggactgg
gtggatcagggaataagaaagaagtacgagaacggaagagaattctgggcgtacggtggt
gacttcggtgacacaccgaatgacggaaacttctgtataaacggtgtggtactgcccgat
agaacacctgagccggaactttacgaggtgaagaaggtctatcagaacgtcaaaataaga
caagtatcgaaagacacttatgaagtggaaaacaggtatctattcacgaaccttgagatg
ttcgatggcgcctggaaaatcagaaaagacggagaggtcatcgaagaaaaaaccttcaag
atcttcgctgaacctggagaaaagcgtctcttgaagataccactcccagaaatggacgat
tctgagtatttcctcgagatcagtttctccctttctgaggataccccctgggcggaaaaa
ggccacgttgtggcgtgggagcagttccttctgaaagcaccggcatttgagaaaaaatcc
atttcagatggagtatcactcagagaagaggggaaacatctcaccgttgaagcaaaagac
acggtgtatgtattctcaaaactcacaggccttctggagcagatccttcacagaggaaaa
aagatcctgaaaagtcccgttgttcccaacttttggagagctccaaccgacaacgacatc
ggaaacagaatgccgcagaggctcgccatctggaagagggcatcgaaagagagaaaactc
ttcaaaatgcactggaaaaaggaagaaaatcgtgtttctgtccatagtgtttttcagctt
ccgggaaacagctgggtgtacacaacatacaccgttttcggaaatggagacatcctagtg
gacctttctctgattctcgctgaggatgtaccggagattccaaggatcggtcttcagttc
acggtccctgaagagttcggcaccgtggagtggtacggaaggggaccgcacgagacttac
tgggacagaaaagaaagtggccttttcgcaaggcacagaaaagctgtcgatgagatgata
cacaggtacgtcaggccccaggaaacggggaacagatcggacgtgagatggtttgcgctt
tccgatggtgaaacaaaactctttgtgtcaggcatgccgcagatagacttcagcgtctgg
cccttttccatggaggatctcgagagggctcagcacataagtgaactcccggagagggac
ttcgtcaccgtgaacgtggacttcagacagatgggccttggaggagacgacagctggggt
gcgatgcctcatctggagtacaggcttctaccaaagccgtatcgtttttctttcagaatg
aggattagcaaagagattccatcctggagggttcttgcggcgatccctgaaacgctccat
gttgagatgtcctcagaagacgtgatacgcgaaggagacaccctgagagtgaaattttcc
cttctgaacgacactccactgagcaaggaagaacaggtggttctctttgttgatggaaac
gaatactcggtgaggcgagtggtgattccacccttcaagaaggaagagctggtgttcaaa
gtagaaggattgaagaagggagaacatctgatacatactaatctgaacacgagaaaaact
atctacgtgaggtga

DBGET integrated database retrieval system