KEGG   Thermotoga sp. RQ2: TRQ2_1758Help
Entry
TRQ2_1758         CDS       T00706                                 

Definition
(GenBank) peptidase M42 family protein
Organism
trq  Thermotoga sp. RQ2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1774886..1775881)
Genome map
AA seq 331 aa AA seqDB search
MKELIRKLTEAFGPSGREEEVRRIILEELEGHIDGHRIDGLGNLIVWKGSGEKKVILDAH
IDEIGVVVTNVDDKGFLTIEPVGGVSPYMLLGKRIRFENGTIGVVGMEGETTEERQENVR
KLSFDRLFVDIGANSREEAQKMCPIGSFGVYDSGFVEVSGKYVSKAMDDRIGCAVIVEVF
KRIKPAVTLYGVFSVQEEVGLVGASVAGYGVPADEAIAIDVTDSADTPKAIKRHAMRLSG
GPALKVKDRASISSKRILENLIEIAEKFDIKYQMEVLTFGGTNAMGYQRTKEGIPSATVS
IPTRYVHSPSEMIAPDDVEATVDLLIRYLGA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaactgatcaggaagctgacggaagcctttggcccaagtggacgggaagaagag
gtgagaagaatcatcctcgaggaactcgaagggcacatagatggccacaggatcgatggg
ctcggcaatctcattgtttggaaaggaagcggcgagaaaaaggtgatactggacgctcac
atagatgagataggtgttgtcgtcacaaatgtggacgacaagggatttctgacgatagaa
cccgtcggcggtgtctctccgtacatgcttcttggaaaaaggatcaggttcgaaaacggt
acaataggcgttgttggtatggaaggtgaaacaacagaagaaaggcaggagaatgtgaga
aagctctcattcgacaggctgttcgtcgatatcggtgcaaattccagggaagaagcgcag
aagatgtgtccgattggaagcttcggtgtctacgacagtggattcgttgaggtttccggg
aaatacgtctcgaaggcgatggatgacaggataggatgtgccgtgatcgtggaagttttc
aaaagaatcaaacccgctgttacgctctacggtgttttcagtgttcaggaagaagtggga
ctggtcggtgcctcggtagcggggtacggcgtaccagcggacgaggccatcgcgatcgat
gtgactgattcggcagacactccgaaggccatcaagagacacgcaatgaggctctccggt
ggacccgctctgaaagtgaaagacagggcatcgatcagcagcaaacgcatcctcgaaaat
ttgatagaaatcgcggaaaaattcgatataaagtatcagatggaggttctgacgttcggc
ggtacgaacgccatggggtaccagcggactaaagaaggaattccttcggccacggtgtct
attcccacacgatacgttcactcacccagtgagatgatcgcaccagatgacgttgaggca
acggtcgatcttctcatcaggtatctgggggcgtga

DBGET integrated database retrieval system