KEGG   Thermotoga sp. RQ2: TRQ2_1759Help
Entry
TRQ2_1759         CDS       T00706                                 

Definition
(GenBank) Cellulase
Organism
trq  Thermotoga sp. RQ2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1775878..1776897)
Genome map
AA seq 339 aa AA seqDB search
MYLKELSMIPGVSGDEGKVRDFIKSKIESLVDNLYTDVLGNLIALKRGRDSSKKLLVSAH
MDEVGFVVSKIEKDGKVAFLPIGGVDSRILPGKVVQVKNLKGVIGYRPIHLQRDEENTPP
RFENLRIDFGFSSADEAKKYVSIGDYVSFVSDYIEKNGRAVGKAFDDRAGCSVLIDVLES
GVSPAYDTYFVFTVQEETGLRGSAVVVEQLKPTCAIVVETTTAGDNPELEERKWATHLGD
GPAITFFHRGYVIPKEIFQTIVDTAKNNDIPFQMKRRTAGGTDAGRYARTAYGVPAGVIS
TPARYIHSPNSIIDLNDYENTKKLIKVLVEEGKIVEVVS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtatctcaaagaactttcgatgataccgggtgtgtctggagatgaagggaaggtcagg
gatttcataaagtcaaagatagaaagtctcgttgacaacctttacaccgatgtccttggg
aatttgatagctttgaaaagaggaagagattcttcgaaaaaactgctcgtttcggctcac
atggatgaggtcggtttcgttgtgagcaaaatagaaaaggacggaaaagtggcgttcttg
cccattggaggagtcgattccaggatacttcccggaaaggtggttcaggtgaagaatctc
aaaggagttatcggctacagaccgatccaccttcagcgcgatgaagagaacactccccca
aggtttgagaatctgagaattgattttggtttttcttctgcagacgaagcgaaaaagtac
gtatcaataggagactacgtctctttcgtgagtgattacatcgaaaagaacggccgggca
gtcgggaaagcgttcgacgacagagcggggtgttctgttctgatcgatgttctcgaaagc
ggtgtgagtcctgcctacgatacgtactttgtcttcacagttcaggaagagacgggactt
cgtggaagtgcagttgtggtggaacagctgaaacccacctgtgccatcgtcgtggaaacc
accacggccggcgacaatccggaactggaggaaaggaaatgggcaacacatctgggtgac
ggtcctgccatcaccttttttcacaggggatacgtgatcccaaaggagatctttcaaact
atcgtggatacagcgaagaacaacgacattccgtttcagatgaagagaagaaccgctggg
ggaacggacgcgggacgttacgccagaaccgcctacggagtgccagcaggtgtgatctcc
actccagcacggtacatccacagtccgaattcgatcatagatttgaacgactacgaaaac
acgaagaaactcataaaagtacttgtcgaggaaggaaaaatcgtggaggtggtctcatga

DBGET integrated database retrieval system