KEGG   Thermotoga sp. RQ2: TRQ2_1767Help
Entry
TRQ2_1767         CDS       T00706                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
trq  Thermotoga sp. RQ2
Pathway
trq00340  Histidine metabolism
trq01100  Metabolic pathways
trq01110  Biosynthesis of secondary metabolites
trq01230  Biosynthesis of amino acids
Module
trq_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    TRQ2_1767
Enzymes [BR:trq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     TRQ2_1767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh FAM25 Ferritin
Motif
Other DBs
NCBI-ProteinID: ACB10098
UniProt: A0A0F6AN58
Position
1783807..1785093
Genome map
AA seq 428 aa AA seqDB search
MILMNNPGDKEVLRLLKQRMESVSQVEETVKEIIRRVKEEGDRALEEFLKRFEKHPVGIE
NLRVTEKEISEAQVEEEFVETIKIVIEDLKEFHRRQEERSFFFTTKGGSFLGEMVVPLES
VGIYVPGGKVPYFSTLLMCAVPAIVAGVERIAVTTPPNENGGISPYILKTCEILGLKEIY
RMGGAHAVAALTYGTETVKPVDKIVGPGGVFVTLAKKHVYGDVGIDSIAGPSEIAIVTDG
SADLDLIAADFLSQAEHDENAMSVVITTSKEVFEKLPQVIERHLEALPEERRKTARISTE
NFGTIILTDSLKRAFEISNLIAPEHLEVLVENPFEPLGHIKNAGSVFLGKYTCESVGDYG
AGPNHVLPTFRSARFSSGLRVSDFTKKIFITHLSEEDFRRKSELYSKMARWEGFEAHARA
IDVRREKL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgattctaatgaacaatcccggggataaagaagtgctcagactattgaaacaaaggatg
gaatctgtatcgcaggtggaagagaccgtaaaagaaatcatcaggagagtgaaagaagaa
ggagacagagccctcgaggaattcctcaaaaggttcgagaagcacccggtgggcatcgag
aaccttcgtgtcacagagaaggaaatatcggaagcccaagtagaggaagaattcgttgaa
acgataaaaatcgtgatagaagacctgaaggaattccatcgaagacaggaggaaagatct
ttctttttcacgacgaagggtggaagcttcctgggagagatggttgttcctctcgagagt
gtgggaatctacgttcctgggggaaaggttccgtacttttccacgctcctcatgtgcgcg
gttcccgctatcgttgctggtgtggaaaggatcgctgtcacaacaccaccgaatgaaaac
ggaggcatctctccatacatcctgaaaacctgcgaaatcctcggtctgaaggagatctac
cggatgggaggggctcacgcggtagccgccctcacatacggcacggaaacagtgaaaccc
gttgacaagatcgtgggacccggtggagtcttcgtcacgctcgcaaagaaacacgtttac
ggagacgttggaatcgattccatagcgggtcccagcgagattgcgatcgtgacagacggc
agtgccgacctggatctcatagccgcggatttcctctcccaggcagagcacgacgagaac
gcgatgagtgtggtgataaccacttcgaaagaagtcttcgaaaaattacctcaggtcatt
gaaagacacctggaagctcttccagaagagagaagaaaaacggccaggatttcaacggaa
aatttcggtaccatcatcttgacggacagtctgaaaagggcctttgagatctccaacctc
atcgcccccgaacatctggaggtcctcgtggaaaacccgtttgagccactgggacacata
aagaacgcgggatctgtctttctcggaaagtacacctgtgagtctgtgggagactacggt
gcgggaccgaaccacgttcttcccaccttcagatccgcgaggttctcctcaggactcagg
gtttccgatttcacgaagaagatattcatcacacacctctccgaagaagatttcagaaga
aagagcgagctttactcgaagatggcgcgctgggaaggttttgaagcccacgctcgggcg
atagacgtcaggagggaaaagctgtga

DBGET integrated database retrieval system