KEGG   Thermotoga sp. RQ2: TRQ2_1767Help
Entry
TRQ2_1767         CDS       T00706                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
trq  Thermotoga sp. RQ2
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:trq01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:trq00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1783807..1785093
Genome map
AA seq 428 aa AA seqDB search
MILMNNPGDKEVLRLLKQRMESVSQVEETVKEIIRRVKEEGDRALEEFLKRFEKHPVGIE
NLRVTEKEISEAQVEEEFVETIKIVIEDLKEFHRRQEERSFFFTTKGGSFLGEMVVPLES
VGIYVPGGKVPYFSTLLMCAVPAIVAGVERIAVTTPPNENGGISPYILKTCEILGLKEIY
RMGGAHAVAALTYGTETVKPVDKIVGPGGVFVTLAKKHVYGDVGIDSIAGPSEIAIVTDG
SADLDLIAADFLSQAEHDENAMSVVITTSKEVFEKLPQVIERHLEALPEERRKTARISTE
NFGTIILTDSLKRAFEISNLIAPEHLEVLVENPFEPLGHIKNAGSVFLGKYTCESVGDYG
AGPNHVLPTFRSARFSSGLRVSDFTKKIFITHLSEEDFRRKSELYSKMARWEGFEAHARA
IDVRREKL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgattctaatgaacaatcccggggataaagaagtgctcagactattgaaacaaaggatg
gaatctgtatcgcaggtggaagagaccgtaaaagaaatcatcaggagagtgaaagaagaa
ggagacagagccctcgaggaattcctcaaaaggttcgagaagcacccggtgggcatcgag
aaccttcgtgtcacagagaaggaaatatcggaagcccaagtagaggaagaattcgttgaa
acgataaaaatcgtgatagaagacctgaaggaattccatcgaagacaggaggaaagatct
ttctttttcacgacgaagggtggaagcttcctgggagagatggttgttcctctcgagagt
gtgggaatctacgttcctgggggaaaggttccgtacttttccacgctcctcatgtgcgcg
gttcccgctatcgttgctggtgtggaaaggatcgctgtcacaacaccaccgaatgaaaac
ggaggcatctctccatacatcctgaaaacctgcgaaatcctcggtctgaaggagatctac
cggatgggaggggctcacgcggtagccgccctcacatacggcacggaaacagtgaaaccc
gttgacaagatcgtgggacccggtggagtcttcgtcacgctcgcaaagaaacacgtttac
ggagacgttggaatcgattccatagcgggtcccagcgagattgcgatcgtgacagacggc
agtgccgacctggatctcatagccgcggatttcctctcccaggcagagcacgacgagaac
gcgatgagtgtggtgataaccacttcgaaagaagtcttcgaaaaattacctcaggtcatt
gaaagacacctggaagctcttccagaagagagaagaaaaacggccaggatttcaacggaa
aatttcggtaccatcatcttgacggacagtctgaaaagggcctttgagatctccaacctc
atcgcccccgaacatctggaggtcctcgtggaaaacccgtttgagccactgggacacata
aagaacgcgggatctgtctttctcggaaagtacacctgtgagtctgtgggagactacggt
gcgggaccgaaccacgttcttcccaccttcagatccgcgaggttctcctcaggactcagg
gtttccgatttcacgaagaagatattcatcacacacctctccgaagaagatttcagaaga
aagagcgagctttactcgaagatggcgcgctgggaaggttttgaagcccacgctcgggcg
atagacgtcaggagggaaaagctgtga

DBGET integrated database retrieval system