KEGG   Thermotoga sp. RQ2: TRQ2_1784Help
Entry
TRQ2_1784         CDS       T00706                                 

Definition
esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
trq  Thermotoga sp. RQ2
Brite
Enzymes [BR:trq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     TRQ2_1784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1797736..1798497
Genome map
AA seq 253 aa AA seqDB search
MNFPRCKTVKKSLPIFLEGGNEGVLFIHGYTGSPHDFEYMAKEVNRAGFTVSVPRLPGHG
TCGEDFLTTTARDWLRRAFDAYYDLKAICDRVYVVGLSMGGVIALILASQMNPPKLVTLA
AATHVFDKRIVLTPILKLFTKKMPRENIEKYEDPDIEYLRKEYWSYNWPKQAAELYKLMK
LARKSVSKITSDTLVVAAKNDNMVPMKAAEFIYNNIRSEKRKLLVFEKSGHVLSNDVEKE
DVTRAVIEWLKGE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaattttccacgatgtaaaactgtgaagaagtcgcttccgatctttcttgagggagga
aacgaaggtgttttattcatccatggatacaccggctctccacacgatttcgagtacatg
gcaaaggaggtaaacagagccggctttactgtttctgttccgagacttccaggacacgga
acctgcggtgaggattttctgacgacaaccgctcgagactggctgagacgcgccttcgat
gcatattacgatttaaaagccatatgcgatagagtctatgtggtgggactttccatgggt
ggtgtgattgctttgatactcgcatctcagatgaatcctcctaaactcgttacactggct
gcagcaactcatgtgttcgacaaaagaatagttctcacaccgattctgaagttgtttacg
aagaagatgcctcgtgaaaacatagaaaagtacgaagacccggacatcgaatacctgaga
aaagagtactggtcttacaactggccaaaacaggcagctgagctttacaaactcatgaaa
ctggcaagaaagagtgtttcaaagatcacatcagacactctcgtcgtcgcggcaaaaaac
gacaacatggttcccatgaaggcagccgagttcatatacaacaacatcagatcagaaaag
aggaagcttcttgtttttgaaaaatccggtcacgttctgagcaacgatgtggaaaaggaa
gatgtcaccagagcagttatcgagtggctgaagggggaatga

DBGET integrated database retrieval system