KEGG   Terriglobus roseus: Terro_0013Help
Entry
Terro_0013        CDS       T02140                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
trs  Terriglobus roseus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:trs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Terro_0013
Enzymes [BR:trs01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Terro_0013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10868..11482
Genome map
AA seq 204 aa AA seqDB search
MIAHLRGRLFSKSPNQAIVDCGGVGYDVAITVPTYSSLPDEGAEIALHINTQVREDAIAL
FGFLDRDEKRLFERLITVSGIGPKLGITVLSGLSATSLVAAIRGGDHATLTKIPGIGKKT
AERVVLELKDKLDDLSSAVPVQGATGFHGGPVIDDVLSALTNLGYKRESAQKAIETAIAK
HETTELTIRTDFDQLFRYSMAAIR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcgctcatcttcgcggacgtctcttcagcaaatcacccaaccaggccatcgtcgac
tgcggcggcgtgggctacgacgtcgccatcacggtgcccacctactcgtcgctcccggac
gagggggcggagattgcgctgcacatcaacacccaggtccgcgaggacgcgatcgctctc
ttcggcttcctcgaccgcgatgaaaagcgcctcttcgagcgactcatcaccgtcagcggt
attggcccgaaactcgggatcacggtgctcagcggcctctccgcgacatcgctcgtggcg
gccatccgcggcggcgatcacgccaccctgacgaagatccccggcatcggcaaaaaaact
gcagagcgcgtcgtgctcgaactgaaggataagctcgacgacctctcaagcgccgtgccc
gtccagggcgcaaccggcttccacggcggccccgtcatagacgacgtgctctctgcgctc
accaacctcggctacaaacgcgagtccgcacagaaggccatcgaaaccgccatcgcaaaa
cacgagaccactgaactcacaatccgcaccgacttcgatcagctcttccgctacagcatg
gccgcaattcggtag

DBGET integrated database retrieval system