KEGG   Terriglobus roseus: Terro_0033Help
Entry
Terro_0033        CDS       T02140                                 

Definition
aldose 1-epimerase-like enzyme
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
trs  Terriglobus roseus
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Terro_0033
Enzymes [BR:trs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Terro_0033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
27960..28883
Genome map
AA seq 307 aa AA seqDB search
MSQTIAELNEHFAIRDHVTFHEDEPGMVKLRIATSASEATLYLQGAHLTQWTPTGQSPVL
YLSPKSALAPGKPIRGGIPVLFPWFGPRWNADAVAVTSPMHGFARVTVWTLERTHLDPNG
DVHITLSLPPDETSRSLGYDHFATKMDFRIGAELHMAITVTNRGAEPMVFEEGFHTYFAV
DDVKEVLLDGLRGSTYLDKRDDMIRKVQRESLFRFTRDVDQVHVKTAEALTIHDTNRQIH
IAKEGSQTTVIWNPWTVLTPGLPDLAEDSWTHFICVEAVNAMDDRITLAPGATHGMSTTV
RLTDKKR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaaccatcgccgaactcaacgagcacttcgccatccgcgatcacgtcaccttc
cacgaagacgagcccggcatggtgaagctccgcatcgccacgtccgcctctgaggccacg
ctctatctgcagggcgcgcacctgacgcagtggacgcccaccggccagagccccgtcctt
tatctctcgcccaaatccgcgctggcgccgggcaagcccattcgcggtggcatcccggtc
ctcttcccgtggttcggaccgcgctggaacgcagacgctgtcgctgtcacctcgcccatg
cacggttttgcacgcgttaccgtctggacgctggaacgcacgcacctcgatcccaacggc
gacgtgcacatcacgctctcgctcccgcccgacgaaacatcgcgctcactgggctacgac
cacttcgcgacgaagatggacttccgtatcggcgcagagctgcacatggccattacggtg
accaaccgcggcgcagagcccatggtctttgaagaaggcttccatacctacttcgccgtg
gacgatgtcaaagaggtcctgctcgacggtctgcgcggcagcacctatctcgacaagcgc
gatgacatgatccgcaaggtgcagcgcgagtcgctcttccgcttcacgcgcgatgtcgac
caggtgcatgtcaaaacggctgaagcgctcaccatccacgacacgaaccggcagatccac
atcgccaaggaaggttcacagacgaccgtcatctggaacccctggactgtcctgacgccg
ggcctgccggatcttgcggaagatagctggacgcacttcatctgcgtcgaggccgtcaat
gccatggacgaccgcatcacgctcgcgcctggcgccacgcatggcatgagcaccacggtt
cgtctgaccgacaaaaagcgttga

DBGET integrated database retrieval system