KEGG   Terriglobus roseus: Terro_0038Help
Entry
Terro_0038        CDS       T02140                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
trs  Terriglobus roseus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Terro_0038
Enzymes [BR:trs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Terro_0038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
32627..33094
Genome map
AA seq 155 aa AA seqDB search
MPLAAIALGSNLGDRAATLASAIRALAAHGEVIARSSDYDTDPVGYADQPRFLNAAALFQ
TTLAPIDLLHALLHIEKQHGRDRSHGIEKGPRTLDLDLLLYEDVILATPELTLPHPEMHR
RRFVLEPLAEIAPAMTHPLLHRTIAQLLAAADPAV
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
ttgcccctcgcagccatcgcactcggatcgaacctcggcgaccgcgcagcaacgctcgcc
tccgccatccgcgcccttgccgcacacggcgaagtcatcgcccgatccagtgactacgac
accgaccccgtgggctacgccgaccagccacgcttcctcaacgccgcagccctgttccag
accacgctcgcaccgatcgatctgttgcacgccctcctgcacatcgaaaagcagcatggc
cgcgaccgctcgcacggcatcgaaaaaggcccacgcaccctggacctggacctgctgctc
tacgaagacgtcatcctcgccacacccgaactcacgctgccacaccccgagatgcaccgg
cgccgcttcgtcctcgaaccgctggcagagatcgcccccgcgatgacgcatccgctgctc
caccgcaccatcgcacaattgcttgcagcggccgacccagccgtataa

DBGET integrated database retrieval system