KEGG   Terriglobus roseus: Terro_0074Help
Entry
Terro_0074        CDS       T02140                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
trs  Terriglobus roseus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Terro_0074
Enzymes [BR:trs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Terro_0074
Exosome [BR:trs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Terro_0074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(78266..79759)
Genome map
AA seq 497 aa AA seqDB search
MSQYILALDQGTTSSRAILFDRVGALIGTAQHEFTQIFPAGKQGWVEHDPFEILTSQMSA
AVEVLGRAGVRPRDVAAIGITNQRETAIVWDRETGRPVYNAVVWQDRRTADACAELVKSG
AEDDVRRRTGLRLDPYFSGTKVAWILDNISGARERAERGELAFGTVDSWLIWNLTSGKRH
ITDRTNASRTLLYNIVEDRWDDELLRLLRVPRSMMPEVVWSSEALGPVSTTLGLEGVEIA
GIAGDQQSALFGQMCTRPGDAKNTYGTGCFLLQHMGSTFRQSEHRLLTTLACSVDRKLEY
ALEGSVFIGGAVVQWLRDGLGIIDSSSDVEALALSVPDSGGVMFVPAFTGMGAPHWDPYA
SGMMIGIGRGTTKAHIARAAVDSIALQTADLMRAMNADTPAPLRELRVDGGAAANNMLMQ
FQADLLSVPVHRPACLETTAMGAAFLAGLAVGFWPNTDEIQRKQDAGTVFQPQHDYSALD
ARWQEAIARAKGWNRPL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaatacattcttgcgctggaccagggcaccacaagttcacgcgctattcttttc
gatcgcgtgggagccctgattggaacggcgcaacatgagttcacgcagatcttcccggcg
ggcaagcaggggtgggttgagcatgatccatttgagatcctgaccagccagatgtcggca
gccgttgaggtgctgggccgcgcgggcgtgcgaccgcgcgatgtggccgcaatcggcatc
acaaaccagcgtgagacggcgattgtgtgggatcgcgagacgggcaggccggtctataac
gccgttgtctggcaggatcggcgaaccgccgacgcgtgcgccgaactggtaaagagcggc
gcggaagatgatgtacgccggcggaccgggctgcggctggatccctacttcagcggaacg
aaggttgcgtggattctggacaacatcagcggcgcccgagagcgagcggagcgcggcgag
cttgcctttggcacggtggactcgtggctgatctggaacctgaccagtggcaagcggcac
atcacggatcgcaccaatgcgtcgcgcacgttgctttacaacatcgtggaagaccggtgg
gacgacgaactgttgcggctgctgcgtgtgccgcggtcgatgatgcccgaggtggtatgg
tccagcgaagcgcttgggccggtgagcacgactctggggcttgagggtgttgagattgcg
ggcatcgcgggggatcagcagtctgcactcttcgggcaaatgtgtacgcggcccggcgat
gcgaagaacacttacggcactggctgctttttgctgcagcacatgggcagcacgtttcgg
cagagcgagcatcggctgctgacgacacttgcctgttcggtcgatcgcaagctggagtac
gcgctggagggttccgtcttcatcggtggcgcagtagtacagtggctccgcgatggtctg
gggatcatcgattcgagcagtgacgtggaggcgcttgcgctgagcgtgccggacagcggt
ggcgtgatgtttgtcccggcgtttactggcatgggtgcaccgcactgggatccttacgcg
tcaggcatgatgatcggcattggccgtggcacgacgaaggcgcatattgcacgcgccgcg
gtagacagcatcgctctgcagacggcggacctgatgcgtgcgatgaatgcagacacaccg
gcgccgcttcgcgagttacgcgtggatggtggcgccgcggcgaacaacatgctgatgcag
ttccaggcggacctgctgagtgtcccggtgcatcggcccgcatgtcttgagacgacggcg
atgggtgcggccttccttgcagggctggctgtcggcttctggcccaacacggacgagatc
cagcgtaagcaggacgcgggtaccgtctttcaaccgcagcacgattacagcgcgctcgat
gcacgttggcaggaagccattgcgcgcgcgaagggatggaacaggccgctatga

DBGET integrated database retrieval system