KEGG   Terriglobus roseus: Terro_0151Help
Entry
Terro_0151        CDS       T02140                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
trs  Terriglobus roseus
Pathway
trs00020  Citrate cycle (TCA cycle)
trs00310  Lysine degradation
trs01100  Metabolic pathways
trs01110  Biosynthesis of secondary metabolites
trs01120  Microbial metabolism in diverse environments
trs01130  Biosynthesis of antibiotics
trs01200  Carbon metabolism
Module
trs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
trs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Terro_0151
  Amino acid metabolism
   00310 Lysine degradation
    Terro_0151
Enzymes [BR:trs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Terro_0151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H HlyD_3 RnfC_N PYNP_C
Motif
Other DBs
NCBI-ProteinID: AFL86502
UniProt: I3ZB84
Position
complement(175199..177172)
Genome map
AA seq 657 aa AA seqDB search
MATEVVMPQMGESITEGTLTKWLKQVGDTVARDEPLFEISTDKVDAEIPSPAAGILTEIK
VQEGATVSINAVVAVLGGEAGGSAPAPAAAEAPAAEAPKVEAAPAPAPAAAPPAAPAASS
TEVPMPQMGESITEGTITKWLKKVGDTVQRDEPLFEISTDKVDAEIPSPATGVLTEIKSA
EGTTVSINTIVAVIGGTAAGSSPTPGAAAPAATAAPAAAAPAASGGASTEVLMPQMGESI
TEGTITKWLKKVGDSVQRDEPIFEISTDKVDAEIPSPVAGTLTEIKAAEGTTVSINTVVA
IIGGAAGSTGTSAPAATPAAAAPAAAAAAPATPTGETPRSSPLVRKMASDNGIDLAAAGI
SGSGSAGRITKNDMVGYIQGGAKPAAAASAPAPSAPVATPATAPATPAVQPTASAAAPAS
APALGELVPMTKMRAIIAKRMVESKATAPHVHSTFRIDMTRIVKLREKEKNKYEQRNGVK
LTFMPFITRATIEALRKHPVVNAAIKGDAIQYNKNINIGIAVSLDWGLIVPVIKQTEEKN
FLGVARGIVDIANRARNKKLAPDDTSGGTFTITNAGIFGGVFGTPIINQPQSAILSIGGL
TKEAMVIPDSDGNDVIAIRSVQWFTLGYDHRLIDGSDAGKFMSDFKNILENWTEDIG
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgaagtcgtcatgccccagatgggcgaatccatcaccgaaggcacactcacc
aagtggttgaagcaggtcggcgacaccgttgcgcgcgacgagcctttgtttgaaatctcc
accgacaaggtggacgcggagatcccatcgcccgccgcgggcattctgaccgagatcaag
gtccaggaaggcgcgaccgtctccatcaacgctgtcgtcgccgttctgggtggcgaggct
ggcggctccgccccggctcccgccgcagcggaagcacctgccgcagaagcaccgaaggtt
gaagcggcacccgctccggcccctgccgccgctcctcccgctgctcccgccgcaagctcc
acggaagtaccgatgccccagatgggcgagtccatcaccgaaggcaccatcaccaagtgg
ctcaagaaggtcggcgataccgtccagcgcgacgagcccctcttcgagatctccaccgac
aaggtcgacgcagagatcccctcgcccgcgaccggcgtcctcaccgagatcaagtccgct
gagggcaccaccgtcagcatcaacacaatcgtcgccgtcatcggcggcaccgcagccggt
tcctcgcctacacccggcgctgccgctcctgctgccaccgctgccccggcagccgccgca
cccgctgcctccggcggagcatccaccgaagtcctgatgcctcagatgggcgagtccatc
accgaaggcaccatcaccaagtggctcaagaaggtcggcgacagcgttcagcgtgacgag
cccatcttcgagatctccaccgacaaggtcgacgccgagattccctcgcccgtcgccggc
acactcaccgagatcaaggccgcggaaggcaccaccgtctccattaacaccgtcgtcgcc
atcatcggcggcgctgctggatccaccggaacatccgctcccgcagcaacacccgccgca
gctgcaccggctgccgcagccgctgcgcccgcaacgccaaccggcgaaacgccacgttcc
tcgccgctcgtccgcaagatggcaagcgacaacggcatcgacctcgccgccgccggtatc
tctggctcgggttccgcaggccgcatcacgaagaacgacatggtcggctacatccagggc
ggcgccaagcctgccgctgctgcaagcgcaccggctcccagcgcaccggtcgcgacacca
gccacagctccggccaccccagcggtccagcccaccgcgtccgcagccgcaccggcatct
gctcccgcactcggcgagctcgtaccgatgaccaagatgcgcgcgatcatcgcgaagcgc
atggtggaatcgaaggcgaccgcgccgcacgttcactccaccttccgtatcgacatgacc
cgcatcgtaaagctgcgcgagaaggaaaagaacaagtacgagcagcgcaacggcgtgaag
ctcaccttcatgcccttcatcacccgcgccaccatcgaggcgctgcgcaagcaccccgtc
gtcaatgccgccatcaagggcgatgccatccagtacaacaagaacatcaacatcggcatt
gccgtctcgctcgactggggcctgatcgtccccgtcatcaagcagaccgaggagaagaac
ttcctcggcgtcgcacgcggcatcgtcgacatcgccaaccgcgcacgcaataagaagctc
gctcccgacgacacctccggcggcaccttcaccatcaccaacgcaggtatcttcggcggc
gtctttggcacccccatcatcaaccagccgcagtcggccatcctgagcatcggcggcctg
accaaggaagccatggtcatccccgactcggacggcaacgacgtcatcgccatccgttcg
gtacagtggttcaccctcggctacgatcaccgcctcatcgacggttccgacgccggtaag
ttcatgagcgacttcaagaacatcctggaaaactggaccgaagacatcggctaa

DBGET integrated database retrieval system