KEGG   Terriglobus roseus: Terro_0364Help
Entry
Terro_0364        CDS       T02140                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
trs  Terriglobus roseus
Pathway
trs00860  Porphyrin and chlorophyll metabolism
trs01100  Metabolic pathways
trs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Terro_0364
Enzymes [BR:trs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Terro_0364
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Terro_0364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 Pyr_redox_2 DUF2169 Pyr_redox MCRA FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AFL86713
UniProt: I3ZBU5
Position
complement(417889..419283)
Genome map
AA seq 464 aa AA seqDB search
MARSVAIIGGGIAGLATAYQLQRLRESGADLAFTLFEQSNRLGGIVETHRQDGFVIECGP
DGWVTDKPWARELAEELGLADEIIPSNDETRVTWVLRDGELLAMPDGMRMMVPERVEAVM
HSPLFSASAREAYAAEPGRAEELKASAPDHDESVADFVKRHFGDEVLRVVGAPLLGGVFG
GDVERLSVRSVMAPFVSMEREHGSLTLALQARAAQRGDRRAATVFTSLRTGTATLIDRMV
AAISPEAILLERSIVSMQRTPGGWTLRDNLGNETAFDHVMLAAPVRVAAALVVPIDAEAA
SLLKIPSSSAVIAGFGYTPEAAPQLPAGFGFLSPEGEDCQLLAGTFADQKFDGRAPQGGK
SIRAYFGGERADALIPRSDEEIAAFAKQELEKVLGPLPAAAVTIVRRWPDALPQYEVGHG
ERMTQLQQRIDAIGALHLLGNGYQGVGLPDLVRDGRAAARSLVA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtggctcgctccgttgccatcatcggtggaggcattgcaggactggccactgcctaccag
ttgcagcgccttcgcgagtctggtgcagatctcgcgttcactctcttcgaacagtcgaac
cgtcttggcggcatcgtggaaacacaccgccaggacggcttcgtcatcgagtgcggtccc
gacggctgggtaacggacaagccctgggcgcgtgagctggcggaagaactcggcctggcc
gatgagatcatcccctccaacgacgagacacgcgtcacgtgggtgctgcgcgacggcgaa
ctcctcgccatgcccgacggcatgcgcatgatggtcccggaacgcgtcgaagccgtcatg
cactcgccgctcttcagcgcctccgcacgggaggcctatgccgccgagcccggccgcgcg
gaagagctcaaagcatccgcacccgaccacgacgaatccgttgcagatttcgtaaagcgt
cacttcggcgatgaggtcttgcgtgtcgtcggcgctcctcttctcggtggcgtcttcggc
ggagacgtcgaacgcctcagcgtgcgctcggtcatggcgccgttcgtctccatggaacgc
gaacatggatcgctgacgttagcactacaggctcgcgcagcacagcgtggcgacaggcgc
gctgcaaccgtcttcacctcgctgcgcacaggcacggcaacgctgatcgatcgcatggtc
gcagccatctctcccgaagcaatcttgctggagcgaagcatcgtctcgatgcaacgtacc
ccgggtggatggaccttgcgcgacaaccttggcaacgagacagcattcgatcacgtcatg
ctcgccgcgccggtccgtgtggccgccgccctcgtcgtacccatcgatgcagaggctgca
tcactgctgaagatcccgtccagctcagcggtcatcgccggcttcggttacacacccgaa
gcagcaccccaactacccgcaggcttcggcttcctctcacccgaaggcgaggactgccag
ctgctcgcaggcaccttcgccgatcagaagttcgacggacgcgcaccgcagggcggcaag
tcgattcgcgcctacttcggcggcgaacgcgcagacgcactcatccctcgcagcgatgaa
gagatcgccgcattcgcaaagcaggagctggaaaaggttctcggcccgctgcccgctgcc
gccgtaaccatcgtgcgccgctggcccgatgccctgccgcaatacgaagtaggccacggc
gaacgcatgacgcagctccaacagcgcattgacgccatcggcgccctgcacctgctcggc
aacggctaccaaggcgttggactgccagacctggtccgggacggccgcgccgcagctcga
tcgcttgtcgcctaa

DBGET integrated database retrieval system