KEGG   Terriglobus roseus: Terro_0535Help
Entry
Terro_0535        CDS       T02140                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
trs  Terriglobus roseus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Terro_0535
Enzymes [BR:trs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Terro_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
603409..604449
Genome map
AA seq 346 aa AA seqDB search
MPTVTAVRSFAKINLGLRIGPPRADGFHHLHTLYQTIGLFDELTVEAERARMTEIHLQCS
DPRVPVDGRNTVYRIVEAALQAMDVTAHVKIFLRKHLPMQGGLGAGSANAAAALLGLERQ
LGIALPGAQRFALAERIGSDVPLFLVGGTVYGHNRGELVMPYPDIPETPCVVVAPGVGSS
TPLAFRAWDERVSSLTPQAAQGRLDELSRVYASAFAPTGPASEIGASGASGALDAGDSVP
HESGSLAGNPLPALVRTGMENDFQEVVFSQHPFLRDILHALQGDEVLPREERAFTASLSG
SGSSLFGLYGSTAAAEAAQARAQALGVRSFVTTTLSRKAYWGGLFV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgccgactgtcactgctgttcgctcgtttgcgaagatcaacctgggtttgaggattggg
ccgccgcgcgcggacggattccatcatctgcacacgctttaccagacgatcgggctgttc
gatgagctgacggtggaggcggagcgcgctcggatgacggagatccatctgcagtgcagc
gatccccgggtgccggtggacgggcggaacacggtctatcggattgtggaagctgcgtta
caggcgatggatgtgacggcgcacgtgaagatctttctgcggaaacatctgccgatgcag
ggcgggctgggcgcggggtctgcgaatgctgcggcggcgctgctgggtctggagcggcag
ttgggtattgcgctgccgggagcgcagcggtttgcgctggcggagcggattgggtcggat
gtgccgctgttcctggtgggagggacggtctatgggcataaccggggcgagctggtgatg
ccttatccggatatcccggagacgccatgcgtggtggtggcgccgggtgtgggatcgtcg
acgccgctggcgtttcgcgcgtgggacgagcgggtgagttcattgaccccgcaggccgcg
cagggtagacttgatgagttgagccgcgtctacgcgtcagcctttgccccaacgggtccg
gcgagcgagatcggcgcctccggtgcttccggggcactcgatgcaggggattctgtcccg
cacgaatctgggagcctggccgggaatcctcttcctgcgcttgtccgtaccgggatggaa
aacgactttcaagaggtcgtcttttcgcagcatccctttttgcgagacattctgcatgcc
ctacagggcgatgaggtccttccgcgggaggagcgtgcctttacggcatctctttcgggt
tccgggtcttccttgtttggtctttatggatcaactgctgccgctgaagcggcccaggca
cgcgcgcaggcgttgggtgtgcggtcgtttgtgacgaccacgctatcgcgcaaggcgtac
tggggcggtctcttcgtttag

DBGET integrated database retrieval system