KEGG   Terriglobus roseus: Terro_0596Help
Entry
Terro_0596        CDS       T02140                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
trs  Terriglobus roseus
Pathway
trs00480  Glutathione metabolism
trs00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Terro_0596
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Terro_0596
Enzymes [BR:trs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Terro_0596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AFL86936
UniProt: I3ZCG8
Position
complement(667639..668193)
Genome map
AA seq 184 aa AA seqDB search
MATDLYSIPVTKIDGSETSLADHRGKVLLIVNVASKCGLTPQYDALEKTYARFHDAGFEV
LGFPANDFGAQEPGSNEEIAQFCRGTFGASFPMFSKIPVTGPSKHPLYATLTQALPESTG
EGKEAFKEGLVRFGATLNPEPEILWNFEKFLIGRDGKPVARFSPDTLPDAPQITQAIEAE
LAKK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgacctctacagcatccccgtaaccaaaatcgatggcagcgaaacatcgctc
gccgaccaccgcggcaaggtcctgctcatcgtcaacgtggccagcaaatgcggcctcaca
ccgcagtacgacgccctcgaaaagacctacgcacgtttccacgatgcaggctttgaagtc
ctcggctttcccgccaacgacttcggcgcgcaggagcccggctccaacgaagagatcgcc
cagttctgccgaggcaccttcggcgccagcttccccatgttctccaagatccccgtcacc
ggcccctccaagcacccgctttacgccacactgacgcaggcactccccgagtccaccggc
gaaggtaaagaagcgttcaaagagggcctcgtccgcttcggtgcaacactcaaccccgag
cccgaaatcctctggaactttgaaaagttcctcatcggccgtgacggcaagcccgttgcc
cgcttctcgcccgacaccctgcccgacgcgccccagatcacccaggccatcgaagcagaa
ctcgcgaagaagtaa

DBGET integrated database retrieval system