KEGG   Terriglobus roseus: Terro_0638Help
Entry
Terro_0638        CDS       T02140                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
trs  Terriglobus roseus
Pathway
trs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
trs01100  Metabolic pathways
trs01110  Biosynthesis of secondary metabolites
trs01130  Biosynthesis of antibiotics
trs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Terro_0638
Enzymes [BR:trs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Terro_0638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AFL86975
UniProt: I3ZCK7
Position
707254..708084
Genome map
AA seq 276 aa AA seqDB search
MTSTETHLDRILALTRVDLPLRRSPERDRLMETMAAAHEPRGFAAALRNAAVTRPAVIAE
LKKASPSKGLIRPTFRPAELAAQLEQGGAACLSVLTDEPFFQGSLEYLKAASENTLLPCL
RKDFIVDEFQILEARAYGADAILLIVAALNDAELKHLRGVARGMGLDVLCEVHDRAELDR
ALPLDCEMVGVNSRNLRTFEVNSAEAEKLAHLLPADVIRVAESGIGSRADIRRMTAAGYN
AFLIGETLMRAPNPGDALLALLQPGVAEIASASIAE
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtacggagacacacctcgatcgcatcctggcgctgacgcgcgttgacctgccg
ttgcgccgttcgccggagcgcgaccgcctgatggagaccatggcggctgcgcacgagccg
cgcggatttgctgcggctctgcgcaacgctgcggtgacccggcctgcggtgattgcggag
ctgaagaaggcatcgccgtcgaaaggtctgatccgccccacgtttcgtcccgctgagctg
gctgcgcaactggagcagggtggtgctgcctgcctgtccgtgctgacggacgagcctttc
tttcagggcagcctcgagtacctgaaggcggcttcggagaacacgctgctgccttgcctg
cggaaggactttatcgtcgatgagttccagatcctggaggcgagggcgtatggcgccgat
gcgattctgctgatcgttgcggcgttgaatgatgcggagctgaagcacctgcgtggtgtg
gctcgcggcatggggctggatgtgttgtgcgaggtgcatgatcgcgcggaactggatcgc
gcgctgccgctggactgcgagatggtgggcgtgaacagccgcaacctgaggacgttcgag
gtgaactctgctgaggcggagaagctggcgcacctgttgcctgcggatgtgatccgtgtt
gcggagagcggcattggctcgcgtgcggatatacgccgcatgaccgctgcgggttacaac
gccttcctgatcggcgagacgctgatgcgcgcgccgaacccgggcgatgcgctgctggcg
ctgctgcagccgggcgtggcagagatcgcatccgcttcgatcgcggagtaa

DBGET integrated database retrieval system