KEGG   Terriglobus roseus: Terro_0642Help
Entry
Terro_0642        CDS       T02140                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
trs  Terriglobus roseus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Terro_0642
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Terro_0642
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Terro_0642
Enzymes [BR:trs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Terro_0642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
710073..711317
Genome map
AA seq 414 aa AA seqDB search
MPVLESVTEVSRSMGSGRFGAYGGRYVPETLMAALLELEQAYMAAREDAAFQTELDDLLK
HYVGRPTPLYFAKRLSESLGGAQIWLKREDLLHTGAHKINNALGQGLLAKRMGKQRIIAE
TGAGQHGVATATVCALLGLDCVIYMGEEDMRRQELNVLRMRLLGAEVRGVNSGSATLKDA
INEAMRDWVTNVRTTFYILGSALGAHPYPTMVRDFHRVISKEAKQQFAAQLGRNPDVVIA
CVGGGSNAIGAFYEFIPDNNVRLIGVEAGGRGSALGDHAARFSSGLPGVLQGTYSYVLQN
DAGQVASTHSVSAGLDYASVGPEHAMLHDSKRAEYVSATDDEALNGVKVLAQTEGILPAL
ETAHAVAHALKIAPTMGKDKVIMINVSGRGDKDMGILSREMDLGGGIAVNQGTT
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgccggtattggagtcagttacggaagtatcgcgatccatgggcagcgggcgcttcggt
gcgtacggcggacggtatgtgccggagacgctgatggctgctctgctggagctggagcag
gcgtacatggcggctcgggaagacgctgcgtttcagacggagctggacgatctgctcaag
cattacgtcggccgtcccacgccgctgtactttgcaaagcgtttgagtgagtcgctgggc
ggcgcgcagatctggctgaagcgcgaagacctgttgcacacgggcgcacacaagatcaac
aacgcgctggggcagggactgctggcgaagcgcatgggtaagcagcgcattattgccgag
acgggcgctggccagcatggtgttgcgacggccacggtctgcgcgctgctggggcttgat
tgcgtgatctacatgggcgaagaggatatgcggcggcaggagctgaatgtgctgcgcatg
cgtctgctgggcgcggaggttcgcggcgtcaacagtggatcggcgacgctgaaggatgcc
atcaacgaggcgatgcgtgactgggtcacgaacgttcgcacgacgttctacatccttggt
tcggcgcttggagcgcatccgtatccgacgatggtgcgcgacttccatcgcgtgatcagc
aaagaagcgaagcagcagttcgccgcacagttgggacgcaatccggatgttgtgattgcg
tgtgttggtggcggatcgaatgcgattggcgccttctacgagttcattccggacaacaac
gtgcgcctgattggtgtggaggcgggtggtcgcggatctgctcttggggatcatgcggct
cgcttcagcagtggtctgccaggtgtgttgcagggtacgtacagctatgtgctgcagaac
gatgcggggcaggtggcctcgacgcattcggtgagcgcggggctggactacgcgagtgtc
ggaccggagcatgcgatgttgcacgacagcaagcgcgccgagtatgtgagtgcgaccgac
gacgaagcgctgaatggtgttaaggttctggcgcagaccgaagggattctgcctgcgctg
gagacggcacatgcagtggcacatgcattgaagattgctccaacgatgggcaaggacaag
gtgattatgatcaacgtttccgggcgtggcgataaggacatgggtatcctcagccgcgag
atggacctgggtggcggcatcgcagtgaatcaggggacaacctaa

DBGET integrated database retrieval system