KEGG   Terriglobus roseus: Terro_0643Help
Entry
Terro_0643        CDS       T02140                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
trs  Terriglobus roseus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Terro_0643
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Terro_0643
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Terro_0643
Enzymes [BR:trs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Terro_0643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
711319..712083
Genome map
AA seq 254 aa AA seqDB search
MPIDFSNKPGLVVYLTAGDPSLDATYEIALAAIDNGAQVIELGVPFSDPLADGPVIQRAS
ERAVARGTRLDDVLKVSKQIREARPEAGIILFSYLNPVVRMGLPAFCEAAKVNGADGVLL
TDMIVEEAGEYLAEMKKHGLAPVFLAAPTSPEERLKAIAEHSQGFVYAISRVGITGAQDQ
IASDAESLVAKIKQYTSLPVAVGFGISKAEHVQGVSRFADAAIVGSAIVALIETSKPGEE
AKNVGQFVRDLRAV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcccattgatttcagcaacaagccgggcctggtggtgtacctgacggcaggcgatcct
tcgctcgatgcgacgtatgagattgcgcttgccgcgatcgacaatggtgcgcaggtcatc
gagctgggcgtgccgttcagcgatccgctggcggacggtcctgtgatccagcgggccagc
gaacgtgccgttgcgcgcggcacgcggctggacgatgtgttgaaggtctcgaagcagatt
cgtgaggcgaggcctgaagcgggcatcatcctgttcagctatctgaaccctgtggttcgt
atgggtttgcctgcattctgcgaggctgcgaaggtcaacggcgccgatggtgttctgttg
acggacatgatcgtcgaggaggccggggagtacctggccgagatgaagaagcatggcctg
gcgccggtgttccttgctgcgccgacgtcgcccgaggagcgtctgaaggcgatcgcggag
catagccaggggtttgtctacgctatctctcgcgtcggcatcacgggcgcgcaggaccag
atcgcttcggatgcggagtcacttgtcgcgaagatcaagcagtacacgtcgctgccggtg
gcggtgggctttggtatctcaaaggcggagcatgtgcagggcgtgagccgctttgcggat
gcggcgatcgtcgggtcggcgattgtggcactgatcgagacgtcaaagccgggtgaagag
gcgaagaatgtgggccagtttgtgcgcgatctgcgcgccgtctga

DBGET integrated database retrieval system