KEGG   Terriglobus roseus: Terro_0643Help
Entry
Terro_0643        CDS       T02140                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
trs  Terriglobus roseus
Pathway
trs00260  Glycine, serine and threonine metabolism
trs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
trs01100  Metabolic pathways
trs01110  Biosynthesis of secondary metabolites
trs01130  Biosynthesis of antibiotics
trs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Terro_0643
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Terro_0643
Enzymes [BR:trs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Terro_0643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: AFL86980
UniProt: I3ZCL2
Position
711319..712083
Genome map
AA seq 254 aa AA seqDB search
MPIDFSNKPGLVVYLTAGDPSLDATYEIALAAIDNGAQVIELGVPFSDPLADGPVIQRAS
ERAVARGTRLDDVLKVSKQIREARPEAGIILFSYLNPVVRMGLPAFCEAAKVNGADGVLL
TDMIVEEAGEYLAEMKKHGLAPVFLAAPTSPEERLKAIAEHSQGFVYAISRVGITGAQDQ
IASDAESLVAKIKQYTSLPVAVGFGISKAEHVQGVSRFADAAIVGSAIVALIETSKPGEE
AKNVGQFVRDLRAV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcccattgatttcagcaacaagccgggcctggtggtgtacctgacggcaggcgatcct
tcgctcgatgcgacgtatgagattgcgcttgccgcgatcgacaatggtgcgcaggtcatc
gagctgggcgtgccgttcagcgatccgctggcggacggtcctgtgatccagcgggccagc
gaacgtgccgttgcgcgcggcacgcggctggacgatgtgttgaaggtctcgaagcagatt
cgtgaggcgaggcctgaagcgggcatcatcctgttcagctatctgaaccctgtggttcgt
atgggtttgcctgcattctgcgaggctgcgaaggtcaacggcgccgatggtgttctgttg
acggacatgatcgtcgaggaggccggggagtacctggccgagatgaagaagcatggcctg
gcgccggtgttccttgctgcgccgacgtcgcccgaggagcgtctgaaggcgatcgcggag
catagccaggggtttgtctacgctatctctcgcgtcggcatcacgggcgcgcaggaccag
atcgcttcggatgcggagtcacttgtcgcgaagatcaagcagtacacgtcgctgccggtg
gcggtgggctttggtatctcaaaggcggagcatgtgcagggcgtgagccgctttgcggat
gcggcgatcgtcgggtcggcgattgtggcactgatcgagacgtcaaagccgggtgaagag
gcgaagaatgtgggccagtttgtgcgcgatctgcgcgccgtctga

DBGET integrated database retrieval system