KEGG   Terriglobus roseus: Terro_0753Help
Entry
Terro_0753        CDS       T02140                                 

Definition
O-glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
trs  Terriglobus roseus
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:trs00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:trs00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
854115..855521
Genome map
AA seq 468 aa AA seqDB search
MTCSRFLLFTSAIVLVTPLTAQTVQAVQTTVDLSRTMVPMPAAKFQKQATAASSSISIDD
SKRFQVIDGFGAAFVEGSAYLLQHELTATQRADVMTKLFSPTQGIGLSAMRLPIASTDLS
RTHYSYDDMPAGEQDPAMAHFSIEKDRVDVFPTVREALKLNPRMTLIASPWSMPAWMKTK
PTMNGGMLREDAEPAFAKYLVRSLQAFQQEGIKPQYLTIQNEPLNETKDYPGTLLKADQA
KRFIGRDLGPALRAAGLKTQVLAYDHNWDHPEYPLEVTADPAARPFTAGSAMHCYGGAVN
AQDGMHNADPTKGIWMTECSGGTWQKQAPLATTADLIIGSTQHWAKAVVLWGIALDPKGN
PHAGGCGTCRGLLTIDSSQHPAKITWNGDFYALEHASKFVHPGAVRVASEATGSGVQQVA
FRNTDGTIALLAFNAGDANQSLSLNWRQRSASVTLPAHSLVTYTWNGR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtgacctgttctagatttctgctcttcacctcggcaattgtgctcgtaacaccactcacg
gcacagacagtgcaagctgtgcagactactgtcgacctgtcacggacgatggtgcccatg
ccagcagctaagtttcagaagcaggctaccgccgcttcgtcttcgatctcgatcgatgac
agcaaacgctttcaagtcatcgatggctttggcgccgcatttgtcgagggttcggcatac
ctgttgcagcacgaactgactgccacgcagcgcgccgatgtcatgacgaaacttttttct
ccgacgcagggaatcggcctgagtgcaatgcgcctgccgattgcatccacggatttatcg
cgcactcactacagctacgacgacatgccagctggggagcaggaccccgcaatggcgcac
ttctccatcgagaaagatcgcgtcgatgtgtttccaacggtgcgggaagcattgaagcta
aatccgcgtatgaccttgatagcatcgccgtggagcatgccggcgtggatgaagaccaaa
cccaccatgaacggtggcatgctgcgcgaagacgcggagccggcgttcgcaaagtatctt
gtgcggtcgctgcaggccttccagcaggaaggtatcaagccgcagtatctgaccatccag
aatgagccgttgaatgagacgaaggattatcccggtacgctgctgaaggccgatcaggcg
aagcgcttcatcggacgtgatcttggcccggcgctacgcgctgccggcttgaagacgcag
gtactcgcgtacgaccacaactgggatcatccggagtacccgctggaagtaactgctgat
cctgctgctcgcccctttactgccggctctgcgatgcactgctatggtggagccgttaac
gcgcaggatggcatgcacaatgccgatccaacaaagggcatctggatgactgagtgttcc
ggtggcacgtggcagaaacaagcgccattagcgaccactgcggatctgatcatcggatcg
acgcaacattgggcgaaggccgttgtcctctggggcatagcgcttgatcccaagggtaat
ccgcatgctggcggatgcggcacgtgccgcgggttgctgaccattgactcttcgcaacac
ccggcgaaaatcacctggaacggtgacttttacgctcttgaacatgccagcaagtttgtt
catccgggagcggtgcgcgttgcctcggaggcgactggctccggcgttcagcaagttgcc
ttccgtaatactgacggcaccattgcgctgcttgcattcaatgccggcgatgcgaaccag
tcgctcagtctgaactggcgccagcgctcggcttcggttacgctccctgcgcattcgctt
gtcacttacacctggaacggtcgctga

DBGET integrated database retrieval system