KEGG   Terriglobus roseus: Terro_0956Help
Entry
Terro_0956        CDS       T02140                                 

Definition
pectin methylesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
trs  Terriglobus roseus
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Terro_0956
   00500 Starch and sucrose metabolism
    Terro_0956
Enzymes [BR:trs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Terro_0956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1067119..1068132)
Genome map
AA seq 337 aa AA seqDB search
MRALALLPLLITLTAQASDVTVLVRPGATPNGPTEFPTIQNAIDHAPEPTAGGRVTIRIT
PGTYKERLWIPQNRPNLTLVGLGTKPEDTVITSDHFAKTSGGTFFTETVEVNGNGFAADN
LTFANTAGNVGQAVAVSVLADRAIFKRCRFLGYQDTLFANYGRQYYVDSYIEGAVDYVFG
NATAVFDRVQFHTVAPGYITAQSRLRPDDPTGYVIRNSHLTFAPGAEGTAMTDNAAKKTA
HGVFLGRPWRPYSRVVFLNTRIDKGLEPAGWSDWNNGNVLTTAFYAEDGSSGPGADTADR
TPFAKRLTSAQRRTFETRTFLNGPDRWNPEAEAAKLP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcgagccctcgccctgctgccactcctcatcaccctcaccgcccaagcgtcggacgtc
accgtcctcgtccgtcccggcgccacgcccaacggcccgaccgagttcccgacgatccag
aacgccatcgaccacgcgcccgaacccacagcaggcggccgcgtcaccatccgcatcacg
cccggcacctacaaagaacgcctctggattccgcagaaccgccccaacctgacactcgtc
ggcctcggcacaaagcccgaagacaccgtcatcacctccgaccacttcgcaaaaacgagc
ggcggcaccttcttcaccgaaaccgtcgaggtcaacggcaacggcttcgcagccgacaac
ctcaccttcgccaacaccgccggcaacgtaggccaggccgtcgcagtctccgtcctcgca
gatcgcgccatcttcaagcgctgccgcttcctcggctaccaggacaccctcttcgccaac
tacggtcgccagtactacgtcgacagctacatcgagggcgcagtcgactacgtcttcggc
aacgccaccgccgtcttcgaccgggtccagttccacaccgtcgcacccggctacatcacc
gcgcaaagccgcctgcgacccgacgaccccaccggctacgtcatccgcaacagccacctc
accttcgcccccggcgccgaaggcaccgccatgaccgacaacgccgcaaagaagaccgcc
cacggagtcttcctcggccgcccctggcgcccctactcccgcgtcgtcttcctgaacacc
cggatcgacaaaggcctcgaacccgccggctggtccgactggaacaacggcaacgtcctc
accacggccttctacgcagaagacggctccagcggccccggcgccgacacagccgaccgc
acccccttcgccaaacgcctcacctcggcccagcgccgcaccttcgaaacccgcaccttc
ctcaacggccccgaccgctggaacccagaagcagaagcagccaaactcccctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system