KEGG   Terriglobus roseus: Terro_0994Help
Entry
Terro_0994        CDS       T02140                                 

Definition
glycosyl hydrolase family protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
trs  Terriglobus roseus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Terro_0994
Enzymes [BR:trs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Terro_0994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1117017..1119446
Genome map
AA seq 809 aa AA seqDB search
MNALTAAYRWLNDQGPAFGAPGLEARWTSSKKDAVCTAYAASSRVWYTISHGTLNEIYYP
TIDRPQTRDMELIFTDGETFVHEEKRDFEFDFHYIDADALAVRVVASDLGGRYTVTKEFV
CDPHHPVVLMHVKIEGEESVLSRLKCYALLAPHLNGGGAGNSARSIEVAGSRCILAWKEN
TSLAMGVDCGFTRSSCGYVGSSDGFQDLASNMRMDWEFGQALDGNIAVMGEIDVARNREF
TLAIAFGDGYHAALAGMMQSLSVPFELHMKRFVEQWHRAASPERLAAASHDGGRLMRISH
NTILAHEDKTYSGAFIASASIPWGNAKGDDDLGGYHLVWTRDMIQSATALLACGRVDTAR
RALVYLACTQRPDGSFAQNFWIDGTPYWTGIQLDEVAFPIMLAWRLWKQDGLGNFDVFPF
IEHAAAFLVHYAPITQQERWEEASGYSPSTLATVISALVCAADVARAHHSPELANFLESY
ADWIEDHLDEWTTTNNGVLHPEIKRHYVRIQPPVAGESFYNPDLGDGRYNIANRQPGERY
NFAANEIIDGGFLELVRYGVRRADDPLIIDSLKVVDHILKIDTPYGACWRRYNHDGYGQQ
KDGEPFVHYGQGRAWPILTGERAHYELAAGGDYAQYVKAIERFSSFGGMLPEQVWDYADM
PEQGLYFGRSAGSAQPLVWAHAEYIKLLRSAVDGRVFDRISVVEERYGVRREDRTFKSEV
EFFQVNRPLTVLPAGKRMQILDQARFRVVWTVDNWVTTHHTDARLIGYPGFAVELPIPAG
ATGTLELTLQWPTEDRWLGKNFQVRLAEV
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcattgaccgccgcctaccggtggctgaacgatcagggcccagcattcggcgct
cccgggcttgaggcccgttggacgtcgagcaaaaaagacgcagtctgtaccgcatacgcc
gcttccagtcgcgtctggtacaccatctcgcacggcacgctcaacgagatttattacccc
accatcgaccgtccgcagacgcgcgacatggaactgatcttcacggatggcgagacgttc
gtccatgaggagaaacgtgacttcgagttcgatttccactacatcgacgccgacgcgctg
gcagtgcgggtggttgcgagcgatctgggtggccggtatacggtgaccaaggagttcgtc
tgcgatccgcatcatcctgtcgtgctgatgcacgtcaagatcgagggggaagagtcggtt
ctgtcgcgtctgaagtgctatgcgctgctggcgccgcacctgaatggcggtggcgcgggt
aattctgcgcgttcgatcgaagtggccggaagccgctgcatcctggcgtggaaagagaat
acgtcgcttgccatgggcgtggattgtggtttcacgcggagttcctgcggttatgtgggg
tcgtcggacggctttcaggatcttgcgagcaacatgcgcatggactgggagtttggccag
gctctggatggcaatatcgccgtaatgggcgagatcgatgttgcgcgcaatcgcgagttc
acgctggcgatcgcctttggcgacggctatcacgcggcgctcgcgggcatgatgcagtcg
ttgtcggtgccgtttgaactgcacatgaagcggtttgtggagcagtggcatcgcgcggca
tcgccggagcgtctggctgcggcatcgcatgatggcggccggctgatgcgcatcagccac
aacacgattcttgcgcacgaggacaagacgtattccggcgcctttatcgcgtctgcgtcg
atcccgtggggtaacgcgaagggcgatgacgacctgggcggctaccacctggtttggacg
cgcgacatgatccagtctgcgacggcattgctggcctgcggacgtgtcgacacggctcgg
cgcgcgctggtctacctggcttgtacgcagcggccggatgggtcgtttgctcagaatttc
tggattgacggaacaccctactggacgggcattcagctcgacgaagtggcttttccgatc
atgctggcgtggcggctttggaagcaggacggtctcggcaatttcgatgtgttcccgttt
atcgaacacgccgcggcgttcctggttcactacgcacccattacgcagcaggagcgttgg
gaagaagcctcgggctattcgccttcgacgctcgcgaccgtgatcagcgcgctggtttgc
gctgcggacgtggcgcgcgcgcaccactcgccggagcttgcgaacttcctggagagctac
gccgactggatcgaagatcacctggacgagtggaccaccacgaacaacggcgtcctgcat
ccggagatcaagcggcactacgttcgcattcagccgccggttgcgggtgagtcgttctac
aacccggatcttggcgacggacgctacaacattgcgaaccgccagccgggagaacggtac
aacttcgccgcgaacgagatcatcgatggcggcttcctggaacttgtccgctatggcgtg
cgccgtgcggacgacccgctgatcatcgattcgctgaaggtcgtcgaccacattctgaag
atcgatacgccctatggcgcctgctggcggcggtacaaccacgacggctacggtcagcag
aaggacggcgagccgtttgtccactacggacaagggcgcgcatggcccatcctgacgggc
gagcgcgcgcattatgagctggctgcgggcggcgactatgcacagtatgtgaaggcgatc
gagcgcttcagttccttcggcggcatgctgccggagcaggtgtgggattacgccgatatg
ccagagcagggcctgtactttggccgcagcgcaggttcggcacagcccctggtgtgggcg
catgccgaatacatcaagctgctgcgctcggctgtcgatgggcgtgtcttcgaccgcatc
agtgttgtcgaagagcgttatggcgttcgtcgcgaggatcgcacctttaagagcgaggtc
gagttcttccaggtcaaccgtccgctgaccgtgctgccagccggcaagcggatgcagatt
ctggatcaggctcgcttccgcgtggtgtggacggtcgacaactgggtgacgacgcaccac
acggatgcccggctgatcggatacccgggatttgcagtggaattgccgatcccggcggga
gctaccggcacactggaactgacactccagtggcccacggaagatcgctggcttgggaaa
aacttccaggttcggcttgcagaggtctga

DBGET integrated database retrieval system