KEGG   Terriglobus roseus: Terro_1000Help
Entry
Terro_1000        CDS       T02140                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
trs  Terriglobus roseus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Terro_1000
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Terro_1000
   00052 Galactose metabolism
    Terro_1000
   00500 Starch and sucrose metabolism
    Terro_1000
   00520 Amino sugar and nucleotide sugar metabolism
    Terro_1000
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Terro_1000
   00524 Butirosin and neomycin biosynthesis
    Terro_1000
Enzymes [BR:trs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Terro_1000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1125910..1126956
Genome map
AA seq 348 aa AA seqDB search
MILAGDVGGTKVDLALYSFDGGKLTVVRTKKFPASGYASLQDVVLEFLKDPDVERKVEEQ
VVAACFGCPGPVKDGHLKLTNLPWELDSRDLSKILDIEHIFLINDLEANGYGIAELGPEQ
VFELEPGDKSAIGHRALVSAGTGLGEALLVWNAAARRHVPLASEGGHVDWAPRNPLEIEM
LIWLQAKLKGRVSSERVVSGLGLKNIYEFLRDGKKMEEPAWLRERLETEDPNFVIGTTGE
DGSCELTAKVLEMFTAAYGAECGNMGLKLLAAGGVYLGGGIPPKILKTLKSGPFRQAFLD
KGRLSPLLHTIPVRVILEEKCALIGAAAYAEARAAELSGHSERAASTP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgattcttgcaggtgatgtaggcggcaccaaggtcgacctggcgctgtatagctttgac
ggtggcaagttgaccgtcgtccgcacgaagaagttccccgccagcggttatgccagcctg
caggatgtggtcctggagttcctgaaggatccggatgtggagcgcaaggtcgaggagcag
gtggtcgctgcctgctttggctgcccgggacctgtgaaggatgggcatctgaagctgacg
aatctgccctgggagctggattcgcgcgacctgtcgaagatcctggatatcgagcacatc
ttcctgatcaacgatctggaagcgaacgggtacggcatcgcagagcttgggccggagcag
gtgttcgagctggaaccgggtgacaagtcggcgattggccaccgtgcgctggtgtctgcg
ggcaccggcctgggcgaggcgttgctggtttggaatgccgctgcgcgacggcacgtgcca
ttggcgagtgagggcggccacgtcgactgggctccgcggaatccgctggagatcgagatg
ctgatctggctgcaggcgaagctgaagggccgtgtgtcctcggagcgcgtggtgagcggc
cttggcctgaagaacatctacgagtttctgcgcgacggcaagaagatggaagagcccgcg
tggctgcgggagcgcctggagacggaagatccgaacttcgtaattgggacgacgggcgaa
gacggatcgtgcgaattgacggcgaaagtgctggagatgttcacggctgcgtatggcgcc
gagtgcggcaacatgggcttgaagctgctggcagcgggcggtgtgtatcttggcggtggt
attccaccgaagattctgaagacgctgaagtcagggccattccgccaggcattcctggat
aagggccggttgtcgccgctgctgcacacgattcctgttcgggtgatcctggaagagaag
tgtgcgctgattggtgcggccgcgtacgcagaggcgcgggctgcagagctgagcggccac
agtgagcgggctgcttcgacgccgtag

DBGET integrated database retrieval system