KEGG   Terriglobus roseus: Terro_1159Help
Entry
Terro_1159        CDS       T02140                                 

Definition
O-glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
trs  Terriglobus roseus
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Terro_1159
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Terro_1159
Enzymes [BR:trs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Terro_1159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1316230..1321050
Genome map
AA seq 1606 aa AA seqDB search
MTPQRYRRSEISQQPTGQPNPLRPDHLLYTLLSHGRRTILTVGVMLGLLGLCHSSQAQDT
FLYNPNHFDTAKIIQAMKTPHSDLRILSAHRGLHAKFGDNPNIAGIPENSLSSVEAAAQA
GLELLEVDVKLTSDRIPICSHDLTWGRETNPAQPGGHVFDPFSSPSPSAQRQANARIDSM
TLAVTQAQFNLRDSVSFLPNYGSHFNVPASLQNVIDRVNLDQIAAVIAIDVKDVDTFKEA
WKIVRVAKDWKGNPFAGHVAWKVSGFNYTTPAAFKADFPDYAAINFWPNYNTSQVAASVF
GSEQAMIDSLNLFWADPSISLIAPEITQKQPGGIFDRMRQMGINTGHTVAEFAAYKDYVY
PNDPNQVAQFFWTGGTNGDGAQLGGSCCVNLRHYFFNPRTNEDGTPNPNYDSTRPTDTAD
DRGDFDFVVNQMRFNVITTDDVIHWDNLLAAGGLRNLSYMRLDGYQGDPQCRANGTYPGC
DQNGQTTYTLCSPEGGTCSFTGDRNVAFGANGTYNTRTITNTTACNVGVFNDPTPGVLKS
CYISPPIDYYTAYGGTIYCADEGQYCNFKGNGSAVMAANHRFSRTFFKATNGFQCDVSTF
SYWGDPAPNIRKACFYTVDQGYVFPHSGPQGYQFCSGEGDTNGCQFKGLGRVAYGASGSF
KYGVFDGGVACTNSVFGDPKPGATKDCYYQWVASAGGASGVSVGGSAAPYDTGGGTGSGN
SGPSKTFTVRAGATTFTASQPNDSVATYTWTDGGQPSEVLTSATGSVLGAAMQSVAVSNY
AGSPTATITVNAGTTFQTIDGFGGAMTDSAAAVMGSSPNRNAIMNILFSPSGGAGLTIVR
SPMGSSDLMASPNDIHTYEDAQGSFSVNGYASDRRQIDLLTQAKSIAGNNFKLLGTPWSA
PGWLKRGGALLPAQCGTDDNEIKIGSVAQYASYFAKYVSAYSALGLRPWMVSMQNEPENC
KTAMPTTLLSPVDEVALAQALKVTLPSDVKVLGWDHNWNDPDYVNTLASQSVRVDGIGYH
CYDGTHYSNQTQSVATYFTECSGFTSGTGNVAGNLGWEVANTLIGPLRYGSRGSVYWSLA
QDPNGNPHLASGDACQNCRGMITVNSDGSFQPSQDYYFWAQFSKFVPPGSVRIDSNNSGD
FSTVAFHNGSTTTLVVLNSTTHADGGSAGSDERDLRRHVVQWDGDTATQKTAWLVGADGY
RRWIGDGSTYNCLIYDAGMLGPDLEAGGALDKYINMRDVWAVCGTAVMGTRSELEVGTYL
KSAGGARLTLTSSGLKSIDATGTSRWAPSGAGNRLILQEDGNLVLYSGTTASWASNTVGS
GAIWLVIRDDGSFALFNKQNQQVWVSPIDASSYRGKMVQWDGDTAAQKTSWMVGYDGNRR
IVHDLGTFQCLHDAGAGNSLTVSSNVLDKLPDLTNVWATCGGTQIGANGALEQGGNLTAG
NNTLVLQTDGNLVLYHGAQVPLWSSDTSGKGGVELKLQSDGNLVLYNQSGSSIWTTGTDG
SNPGWFILGTDATLQLFDASGNRIWSRTSTDVIPAPTAGYNFCATEGGTCNFTGAGRVLF
GARGKATYTWKDVTNGTPCTTAAFGTDPNPGLVKTCWYSTPPRPLQ
NT seq 4821 nt NT seq  +upstreamnt  +downstreamnt
atgactccccagcgttatagacgctcagagatttcgcagcagccgacaggccagccaaac
cctttacgccccgaccatcttctgtacacgctcttgtcgcacggcaggcgcacgatcctg
acagtcggtgtgatgctaggcctgctagggctttgccattcctctcaagcccaggacact
tttctctacaatcccaatcattttgatacggcaaaaatcatccaggcgatgaagactccg
cacagcgatctgcgaatcctgtccgctcatcgtggcctgcatgccaagtttggggacaat
cccaacatcgctggcataccggagaattcgctcagttcggtcgaagccgcagcacaggcc
gggctggagcttctggaagtggatgtaaagctcacctcggacagaattccaatctgcagt
catgaccttacctgggggcgtgagaccaatcccgcgcagcccggaggtcacgtcttcgac
ccgttcagctctccatcgccctcggctcaaaggcaggcaaacgcgcgaatcgattcgatg
accttggccgtcacgcaggcgcaatttaacctgcgagattctgtttccttcctcccgaac
tatggaagtcacttcaatgtccccgcctcgctgcaaaatgtcatcgaccgggtcaatctc
gatcagattgctgccgtcatagccatcgatgtcaaggacgtagacactttcaaagaggca
tggaagatcgtgcgggtggccaaagactggaaaggaaatcctttcgcagggcacgtcgca
tggaaggtcagtggattcaattacacgacgccagccgccttcaaggcggacttcccagac
tatgctgcgattaatttctggccaaactacaatacttcccaggtcgctgcgagtgtattt
gggagcgaacaggcgatgatcgactcgttgaacctgttctgggcagacccttcgatcagt
ttgattgcgccggaaataacgcaaaagcaacccggtggtatcttcgacaggatgcggcag
atgggcatcaatactggacacacggttgccgaatttgccgcctacaaagattacgtctat
ccgaatgacccaaaccaggtcgcacagttcttctggacaggcggcacgaatggggacgga
gcccagctcggtggatcatgctgcgtaaatctcaggcattacttcttcaatccaagaaca
aatgaagatggcactccgaacccgaactatgactcaactcggccgacggataccgccgac
gatcgtggtgactttgattttgtagtcaatcagatgaggttcaacgtcatcaccacggac
gacgtgatccactgggataatctgctcgcggctggcggcctccggaatcttagctatatg
cgactcgatggctatcaaggggatcctcagtgcagggcaaatggtacttaccccggctgc
gaccagaacggacaaaccacatataccttgtgctcccctgagggaggaacgtgcagcttc
acaggtgatcgaaacgtagcattcggcgcgaatgggacatataacacccgcacgatcacc
aacactacagcctgtaatgtcggggtcttcaatgaccccactcccggcgttctcaagagc
tgctacatcagtccccccatcgactattacaccgcgtatggtggaacgatctactgcgcc
gatgaaggccaatattgcaacttcaaaggcaacggatccgcagtcatggcggcgaatcat
cgtttctctcgaacctttttcaaagccacgaatggcttccaatgcgatgtttcgacgttc
agctattggggtgatcctgctccgaatatcaggaaggcgtgtttttacacggtcgatcag
gggtatgtctttccacattccggtccacaggggtatcagttctgctcgggtgagggcgac
acaaacgggtgccagttcaagggcctagggcgtgttgcatacggcgccagtggctccttt
aaatatggagtcttcgatggaggagttgcgtgcacgaactccgtcttcggtgatcccaaa
ccgggggccacaaaagattgttactaccagtgggttgcgtccgcaggcggagcttcgggt
gtcagcgtcggtggctcagccgctccctatgacacaggcggcggcaccggaagcggtaat
tcgggaccttcgaagaccttcacggtcagagcaggagcgaccacgttcacggccagtcag
ccgaacgattctgtggctacctatacctggacagacggaggtcagccgtccgaggtgctg
acaagtgccaccggcagcgtgttaggcgcggccatgcaatcggttgcggtgagtaactac
gccgggtctcccactgccacgattaccgtaaatgcgggtaccaccttccagaccatcgat
ggattcggcggtgccatgacggattcggcagctgcagtgatgggctcctctccaaatcgc
aatgccatcatgaacatcttgttctctccaagtggtggcgccggcttgacgatcgtccga
tcgcctatgggatcaagcgacttgatggcttccccaaacgacatccacacgtatgaggac
gcgcagggcagtttctctgtgaacggctatgcaagcgaccggaggcagatcgacctgctc
acgcaggccaagtcgattgcgggcaacaacttcaaattgcttgggaccccttggagtgct
ccgggctggctcaagcgtggaggcgcattattgccggcacagtgtggtacggacgacaat
gagatcaaaatcggctccgttgcgcaatatgccagttattttgcgaaatatgtaagcgct
tacagcgccttgggattgaggccgtggatggtctccatgcagaacgagccggaaaattgc
aagacggcgatgccaaccacgctcctatcgcctgttgacgaggtcgctcttgcacaagca
ctcaaggtaactctgccgagtgatgtgaaggtgcttggctgggaccataactggaatgac
ccagactacgtcaatactctcgccagccaaagtgtgcgagtcgacggcattggctaccat
tgttacgatggcacccactacagcaatcagacgcagtctgtagcaacttactttaccgag
tgctccgggttcaccagcggcacaggaaacgtggccggcaacctgggctgggaagtcgca
aacacattgattgggccgctccgttatggatcacgcggatcggtctactggtctcttgcg
caggacccgaatggtaacccgcatctggcaagtggcgacgcctgccagaactgccgtggc
atgatcactgttaacagcgacggcagctttcagccgagccaggactattacttctgggct
caattctctaaatttgttccgcccggctctgtgcggatcgactccaacaactccggagat
ttttcgactgttgccttccacaatgggagcaccacaacccttgtggtgctgaactcgaca
acgcacgcagacggagggtccgccggttcggacgaacgggatctgagaaggcatgtagtc
caatgggacggggacaccgcaactcagaagactgcctggctggttggggcagatggctat
cgtcgctggattggcgatgggtcgacttacaactgtcttatctatgacgccggtatgctg
ggacctgacctcgaggcaggtggtgctctcgataagtacatcaacatgcgcgatgtttgg
gctgtgtgcggaacagccgtgatgggtactcggagcgagctcgaagttggcacctatctc
aaatcggctggcggcgcgcgtctcacgttgaccagcagcgggctgaaaagcatcgatgcg
acaggtacgtcacgttgggctccgtcgggagcaggcaatcgactcattctgcaggaggat
ggaaaccttgtcctgtactctggcaccacggcgtcatgggcaagcaacaccgtgggttct
ggtgcaatctggctggtaatccgggatgacggttcgtttgcattgttcaacaagcaaaac
cagcaggtctgggtaagcccgattgatgccagctcttaccgaggcaagatggtgcaatgg
gacggtgatactgccgctcagaagacctcatggatggttggctatgatggcaaccggcgg
attgtccatgacctgggcacgttccagtgtcttcatgacgctggtgctggaaactccctt
accgtgagcagcaatgttctcgacaaactccccgacctcaccaacgtctgggcgacttgc
ggcgggacccagatcggcgccaatggagcccttgaacagggaggtaatctcaccgctggc
aataacaccctcgttcttcagacagacggtaacctggttttgtaccatggcgcccaggtt
ccactgtggtcgagcgacaccagcggcaagggtggcgtcgagctgaaactgcagtccgac
ggtaaccttgtcctctacaaccagagcggatcctccatctggactaccggcaccgacggt
tccaaccccggttggttcatcctcgggacggatgcgaccctgcagctcttcgatgcatcg
gggaaccgaatctggagccgcacgtcaaccgatgttattcccgcgcccacagcagggtat
aacttctgcgcgactgagggtggaacatgtaacttcacgggtgccggaagggtgctattc
ggagcgcgtgggaaggcaacgtacacctggaaggatgtcacgaacggcactccatgcact
accgctgctttcgggaccgatccgaaccctggcctggttaagacctgttggtacagcaca
cctcctcggcctcttcaatga

DBGET integrated database retrieval system