KEGG   Terriglobus roseus: Terro_1215Help
Entry
Terro_1215        CDS       T02140                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
trs  Terriglobus roseus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Terro_1215
Enzymes [BR:trs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Terro_1215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1404852..1406522
Genome map
AA seq 556 aa AA seqDB search
MPHASFDSLRVVSLESRRAREVEKLIRTYNGEPIVVPSMREVPLSSNAACLQFGHDLLAD
RFDAIIFFTGVGVRAMMRILETEFPRENLLEKLRGLTVISRGVKPQAALIELRVPITALA
PEPATWHEVMSVLDTTLGDRAAGMRLAVQEYGASNPEMLSELVNRFDSVTKVPVYQWALP
EDLEPLRSVVREIVRGSVDVVLFMTAVQVIHLFQVADEISMQDDLRLALASTVVVSVGPT
TTEELQQYGVKPDFEPSRPKMGFMINEAAQYAGKLLAAKRASLPPDDLSAALPPPSATRK
TPASGVQQVAAMTATMAGFTDGLAPLDILHEIGSRIALADPLHLVLERIVKFACAVIPCD
SCFVYTVEGEQLILRASKNPHADQVDTLNVPVGEGITGWVAKHRESVAIPKAASEDPRFS
FFALLPEDRFEAMLSTPLVCANRVIGVINVQHRDPYFHSDLQRRLLATLGILVGAEIERA
RLETENLDLSQRLESRKVIDRAKGLLQAELGITEEEAYLTMQKESRQRRRSMRDIAEAIL
LSEKLRQKPTMSESRA
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgccgcatgcaagcttcgatagcctccgagtcgtctctctggaatcgcggcgcgcgcgc
gaagtcgagaagctcatccggacctacaacggcgaacccatcgtcgtgccatcgatgcgc
gaggtcccactcagctcaaacgcagcatgcctccaattcggacacgacctgctggccgac
cgcttcgacgcgatcatcttcttcaccggtgtcggcgtccgcgccatgatgcgcatcctc
gaaaccgagttcccccgcgaaaacctgctcgaaaaattgcgcggcctcaccgtcatctca
cgcggcgtcaagccgcaggccgcactcatcgaactgcgtgtgccgatcaccgccctcgca
cccgaacctgcgacctggcatgaagtcatgtccgtcctcgacaccaccctcggcgaccga
gccgcaggcatgcgcctcgccgtgcaggaatacggcgccagcaatccagagatgctctcg
gagctcgtcaaccgattcgactccgtcaccaaagtccccgtctatcaatgggcgctgccg
gaagatcttgagccgctgcgcagtgtcgtgcgcgagatcgttcgcggctccgtcgatgtc
gttctcttcatgacggccgtgcaggtcatccacctcttccaggtcgccgacgaaatcagc
atgcaggacgatctcaggctcgccctcgcctctaccgtcgtcgtctccgtcggacccacc
acaacagaagagctgcagcagtacggcgtgaaacctgacttcgaaccatcccggccgaag
atgggcttcatgatcaacgaagcagcgcagtacgcgggtaagctgctcgcggcaaagcgc
gcctccttgcctccggacgatctaagcgccgcgctccctccgccatccgccacccgcaag
acaccagcctccggcgtgcaacaggtcgcagccatgaccgcgaccatggccggcttcacc
gacggcctcgccccgctcgacatcctgcatgagatcggcagccgcatcgccctcgccgac
cccttgcacctcgtcctcgaacgcatcgtaaagttcgcctgcgccgtcatcccctgcgac
tcctgcttcgtctacaccgtggaaggcgagcagctcatcctgcgcgccagcaaaaatccg
cacgccgaccaggtcgacacactcaacgtacccgtcggcgaaggcatcaccggctgggtc
gccaagcaccgcgaatccgtcgccatccccaaggccgcatcagaagacccgcgcttcagc
ttcttcgcactgcttccggaagaccgctttgaggccatgctcagcacgccgctcgtctgc
gccaatcgcgtcatcggcgtcatcaacgtgcagcatcgcgacccctacttccacagcgac
ctgcagcgccgcctgctcgcaacgctcggcatacttgtcggtgcagagattgaacgcgcc
cgcctcgaaacggaaaatcttgacctctcccagcggcttgaaagtcgcaaggtaatcgac
cgcgccaagggcctgttgcaggccgaactcggcatcacggaagaagaggcctacctcacc
atgcagaaagagagccgacagcgcaggcgctccatgcgagacatcgcggaggccatcctg
ctctcagaaaaactcaggcagaagccaacgatgagtgagtccagggcctag

DBGET integrated database retrieval system