KEGG   Terriglobus roseus: Terro_1270Help
Entry
Terro_1270        CDS       T02140                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
trs  Terriglobus roseus
Brite
Enzymes [BR:trs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Terro_1270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1487859..1488992
Genome map
AA seq 377 aa AA seqDB search
MKILGALALAALIAPAQTGKAPTTLKDAYKPYFKIGVAINERQFDERDPTAAAIIASQFN
TISPENALKWESIHPRLDTFNFTPADHYVSFGEKNRMFIVGHCLIWHSQVPKWVFEDAEG
KPLTREALLERMHDHIRTVVGRYKGRIGGWDVVNEAINDDGTMRQSPWFRIIGEDFIEKA
FQYAHEADPSAELYYNDYSLENDAKRRGALALIRKLKTDGVPITGIGLQGHVKIDSPSAQ
KEAKTIEDFAALGIRVNISELDVDVLPRTTRSDSADVSTIAAGSAAANPYTAGLPEEQQQ
ALARRYAELFNVFLQHHKSMGRVTLWGLSDANTWLNNFPTRGRTNYPLLFDREMKSKPAF
TSVLDDAKNFRETNGTR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcttaggagcgctcgcgctcgcagccctgatcgcgccagcccaaacagggaag
gcgcccaccacactcaaggacgcctacaagccctacttcaaaatcggcgttgccatcaat
gaacgtcagttcgacgaacgcgaccccaccgctgcggccatcatcgcctcccagttcaac
accatcagccctgaaaacgccctcaagtgggaatccatccacccgcgtctcgacaccttc
aacttcacgcccgcagaccactacgtctccttcggcgagaagaacaggatgttcatcgta
ggccactgcctcatctggcacagccaggtgcccaagtgggtcttcgaagacgcggaaggc
aaacccctcacgcgcgaagcactcctcgaacgcatgcacgatcacatccgcaccgtcgtc
ggccgctacaaaggccgcatcggcggttgggacgtcgtcaacgaagccatcaatgacgac
ggcaccatgcgccagtcgccctggttccgcatcatcggcgaagacttcatcgagaaagcc
ttccagtacgcacacgaagccgatcccagcgccgagctctactacaacgactactcgctc
gaaaacgacgccaagcgcaggggcgccctcgcgctcatccgcaaactcaaaaccgacggc
gtccccatcaccggcattggtctccagggccacgtcaagatcgacagccccagcgcgcag
aaggaagctaaaaccatcgaagacttcgccgccctcggcatccgcgtcaacatcagcgaa
ctcgacgtcgacgtcctgccccggaccacccgttcggactcagccgacgtctctacgatc
gcagcaggatcggcagccgcaaacccctacaccgcaggcctcccggaagagcagcagcag
gcactcgcgcgtcgctacgccgaactcttcaacgtcttcctgcagcaccacaaatccatg
ggacgcgtaacactctggggcctcagcgacgccaacacatggctcaacaacttcccaacc
cgaggccgcaccaactacccgctgctcttcgatcgggagatgaagtccaagcccgccttc
acgtccgtactcgatgacgcgaagaacttccgcgagacaaacggcacacgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system