KEGG   Terriglobus roseus: Terro_1339Help
Entry
Terro_1339        CDS       T02140                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
trs  Terriglobus roseus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Terro_1339
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Terro_1339
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Terro_1339
Enzymes [BR:trs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Terro_1339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1576983..1578281
Genome map
AA seq 432 aa AA seqDB search
MSSASSACTPYELYSKESGKSYGNQPLSICDESFTPLEVRYDLEAARTIFTKKAIEAGPD
NMWRYSGLLPIPEGFQPDLPVGLTPLVRAKSLGKRLGASNLYVKNDAVCFPTLSFKDRVV
AVALANARAFGFDVVGCSSTGNLANSVAAQSARLGMKSCILVPADLEPAKILNTLIYGAR
LVRIDGNYDHVNRLCSLIADQYNWGFVNVNLRPYYAEGSKSVGYEIAEQLGWKLPDNVVV
PMAGGSLIRKIKKAFDELAFLGLVEAKHVRFFGAQATGCSPIAQAVKNNTETITPQKPNT
IARSLAIGNPADGPFASRMIRETGGWAEDVSDVEIVSGIQELAETEGIFTETAGGVTTAV
TARLIAQGRIVADETTVVCITGNGLKTTDCIADRFTLGRAVRPRLADFEDYINELDGITA
PAEPELAIAGGK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgcctcgtctgcgtgtaccccgtacgagctctactccaaggagtcgggcaag
agctatggcaaccagccgctctccatctgcgatgagtcgtttacgccactggaagtgcgc
tacgacctggaagccgcacgcaccatcttcacgaagaaggccatcgaagccggccccgac
aacatgtggcgctacagcggcctgctgcccatccccgagggctttcagcccgacctgccc
gtcggcttgacgccgctggtgcgtgcaaagagcttgggcaagcgcctgggcgcaagcaat
ctctatgtgaagaacgacgccgtctgctttcccacgctgtcgttcaaggaccgcgtcgtc
gctgtggcgctcgcgaacgcccgcgccttcgggttcgatgtcgtcggctgctcttcgacc
ggcaatcttgcaaactcagtcgctgcgcagtccgcccggcttggcatgaagagctgcatc
ctcgtcccagccgaccttgagcccgcgaagatcctcaacaccctcatctacggcgcgcgc
ctcgttcgcatcgacggcaactacgaccacgtcaaccgcctctgctcgctcattgccgac
cagtacaactggggcttcgtgaacgtgaatctgcgaccctactatgctgagggttcgaag
tcggtcggctacgagatcgcagaacagctcggctggaagctgcctgacaacgtcgtcgtg
cccatggccggcggttcgctgatccgcaagatcaagaaggccttcgacgagcttgccttc
ctcggcctggtcgaagcgaagcatgtacgcttcttcggcgcacaggctaccggctgctcg
cccatcgcgcaggctgtgaagaacaacaccgaaaccatcacaccgcagaagcccaacacc
atcgctcgctcgctggccatcggcaacccggcagacggtcccttcgcctcacgcatgatt
cgtgagacgggcggctgggctgaggatgtctcagacgtcgagatcgtcagcggcatccag
gaactggcggagacagaaggcatcttcaccgagaccgccggcggcgtgacgaccgcagtt
accgcgcgcctcatcgcgcagggacgcatcgttgcggacgagaccacggtggtctgcatc
acgggcaacggcctcaagactaccgattgcatcgcagaccgctttacgctgggccgcgca
gttcgcccgcgtctggcggactttgaggattacatcaacgagctggacggcatcactgca
cctgcagaacccgaactggccattgcaggagggaagtaa

DBGET integrated database retrieval system