KEGG   Terriglobus roseus: Terro_1392Help
Entry
Terro_1392        CDS       T02140                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
trs  Terriglobus roseus
Pathway
trs00520  Amino sugar and nucleotide sugar metabolism
trs00550  Peptidoglycan biosynthesis
trs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Terro_1392
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Terro_1392
Enzymes [BR:trs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Terro_1392
Peptidoglycan biosynthesis and degradation proteins [BR:trs01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Terro_1392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: AFL87701
UniProt: I3ZEN3
Position
complement(1647434..1648720)
Genome map
AA seq 428 aa AA seqDB search
MDKFVVRGGNPLLGTIKVSGAKNSALPCMAAAILTADEVVLENIPQVRDIETERKLLEAM
GAQVELGYGRAQHRTTIQCAVLSDPQAKYEIVKTMRASSLVLGPLVARTGMARVALPGGC
TIGDRPIDLHLKGLEAMGARITQEYGYVEARTERLKGAHIVFDKITVTGTEDLLMAATLA
EGETVMENCAQEPEVTDLAAMLIGMGAKIEGAGTSTIRVQGVDKLHGVRHRINPDRIEAG
TFLIAGAISGGDLNVDCCNPAHLAAVISKLEECGVRMDVGKDNIRVRSEGRGSLKAADIS
TVEYPGFPTDMQAQYMALATQAEGTSSVTENIFENRFMHVSELVRMGADIKVHGRTATIT
GRTPLQAAAVMCSDLRASASLVLAALVADGETILDRVYHIDRGYEHIEEKLRGVGAQIRR
MGEVFGKR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggataagtttgtcgtccgcggcgggaatcccctgctcggcaccatcaaggtctctggc
gcaaagaactcggcacttccctgcatggctgcggccatcctcactgcagacgaggttgtg
ctcgaaaacatcccccaggtccgcgacatcgagaccgagcgcaaactgctggaagccatg
ggcgcgcaggtcgagctgggctacggccgcgcacaacatcgcaccaccattcagtgcgcc
gtgctcagcgaccctcaggccaagtacgagatcgtcaagaccatgcgtgcgtcctcgctg
gtgcttggaccgctcgtcgcccggaccggcatggcacgtgtcgcacttcccggcggctgc
accatcggcgatcgccccattgacctgcacctgaagggtctggaggcgatgggcgccagg
atcacgcaggaatacggctacgtcgaagcgcgcacggaacgcctcaagggcgctcatatc
gtcttcgacaagatcaccgtcaccggcaccgaagacctcctgatggccgcaacactcgcc
gagggtgagaccgtcatggagaactgcgcgcaggagccggaagtcaccgacctggcagcc
atgctcatcggcatgggtgcaaagatcgaaggcgctggcacctccaccatccgcgtgcag
ggcgtcgataagctccacggcgtacggcaccgcatcaaccccgaccgcattgaggccggc
accttcctcatcgccggcgctatctccggcggcgacctcaacgtcgactgctgcaacccc
gctcacctggctgctgtcatcagcaagctggaagagtgcggcgtgcgcatggacgtgggc
aaggacaacatccgcgtccgcagcgaaggccgtggatcgctcaaggccgcagacatctcc
accgtcgagtacccgggcttcccaaccgacatgcaggcgcagtacatggccctggcaacg
caggcggagggcacctccagcgtgacggagaacatcttcgaaaatcgcttcatgcacgtc
agcgaactggtgcgcatgggcgcagacatcaaggttcatggccgcacggccaccatcacc
ggccgcacaccgctgcaggccgctgccgtcatgtgcagcgacctgcgcgcatccgcatcg
ctcgtactggcagcgctcgtcgctgacggcgaaacgatcctcgaccgtgtctaccacatc
gaccgtggctacgagcacattgaagagaagctgcgcggcgtcggtgcacagatccggcgc
atgggcgaagtcttcggcaagcgttaa

DBGET integrated database retrieval system