KEGG   Terriglobus roseus: Terro_1399Help
Entry
Terro_1399        CDS       T02140                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
trs  Terriglobus roseus
Pathway
trs00010  Glycolysis / Gluconeogenesis
trs00051  Fructose and mannose metabolism
trs00562  Inositol phosphate metabolism
trs01100  Metabolic pathways
trs01110  Biosynthesis of secondary metabolites
trs01120  Microbial metabolism in diverse environments
trs01130  Biosynthesis of antibiotics
trs01200  Carbon metabolism
trs01230  Biosynthesis of amino acids
Module
trs_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Terro_1399
   00051 Fructose and mannose metabolism
    Terro_1399
   00562 Inositol phosphate metabolism
    Terro_1399
Enzymes [BR:trs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Terro_1399
Exosome [BR:trs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Terro_1399
  Exosomal proteins of bladder cancer cells
   Terro_1399
  Exosomal proteins of melanoma cells
   Terro_1399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFL87708
UniProt: I3ZEP0
Position
complement(1656307..1657062)
Genome map
AA seq 251 aa AA seqDB search
MRKKIIAANWKMYKTPMESLEFLNAFLPKVHDHEKAEIVIFPTATSLSTVIDRVRGTHVR
AGAQTMHWLNEGPYTGQTSPTMLTSIGATHVLLGHSERRLYANESYEQVSLKLKAAIAHA
LTPVLCLGEMLADRQGGFTKDTLMAQMGAALSNLPASSAGTLVVAYEPVWAIGTGSTASP
EVANEVHAIIRSELARVFNYEIAENTRILYGGSVKPENSASLLSQSDIDGLLIGGASLDP
KSLAKIVHTHI
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagaaaatcattgcggcaaactggaagatgtacaagactccgatggagtcgctt
gagttcctgaacgcctttctcccgaaagtgcacgaccacgagaaggccgagatcgtaatc
tttcccacggcgacctcactctcgaccgtcatcgatcgcgtgcgcggcacgcacgtccgc
gccggcgcgcagaccatgcattggctgaacgagggcccctacaccggtcagacatcgccc
accatgctcaccagcatcggcgcaacacacgttttgctcggtcactccgaacgccgtctc
tatgccaatgaaagctacgagcaggtcagcctcaaactgaaggccgccatcgcgcacgcc
ctcacgcctgtcttatgcctgggcgagatgctggcggaccgccagggcggcttcaccaag
gacacgctgatggcacagatgggcgccgcgctctccaacctgcccgcctccagcgccggc
acgctggtcgtcgcgtatgagccagtctgggccattggcaccggatccaccgccagcccc
gaagtcgccaacgaagtgcacgccatcattcggagcgaactcgcacgtgtcttcaactat
gagatcgcagagaacacgcgcatcctctacggcggttcggtaaagcccgagaacagtgcc
tcacttctctcgcagtcggacatcgacggcctcctgatcggtggagccagtctggatccg
aagtcgttggcgaagatcgttcacacgcatatttga

DBGET integrated database retrieval system