KEGG   Terriglobus roseus: Terro_1433Help
Entry
Terro_1433        CDS       T02140                                 

Definition
(GenBank) endoglucanase Y
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
trs  Terriglobus roseus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1691180..1692364
Genome map
AA seq 394 aa AA seqDB search
MLGEAGNKWGWRRWVAVAIALSTLSLQTGCRAEVPWPLWQQYRARFIDGSGRVIDHSPGA
NEKTTSEGMAYGMFFALVVNDRPTFDKLLRWTEDNLAGGDLTARLPAWNWGKSPDGEWKP
LDTNSASDADLWMAYDLLEAGRLWKDDRLTKLGDVMMDRIAHTEVAVSPSLGTVLLPGPT
GFKPQPNTMILNPSYSPPQVLARLKAEQPSGPWEAALDALPRLIAASAPSGFAMDWVLSG
AKTVPSVSPTDLAAGNTTVAPVGGFESIRVYLWLGMADKGTAVVQRSLQSVGGMARLMES
TVTPPMQVDAAGTVVNADGPVGFSAAVIPYLLAVGHKDQATAQANRMAASVDSASGLYGR
TPLYYDQNLAMFSNGWTEGRFKFDRDGKLKVKWK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcgaggcagggaataagtggggatggcgccggtgggttgccgtggcgattgcg
ctgagtaccttgtcgctccagacgggatgccgtgcggaggtgccctggccgctttggcag
cagtaccgcgcgaggtttatcgacggttccggacgcgtgatcgatcacagcccgggggcg
aacgagaagacaaccagcgaaggcatggcgtacggcatgttctttgcactcgtcgtcaac
gaccggcctacgttcgacaagctgctgcgctggacagaggacaacctggcgggcggcgac
cttacggcgcgcctgcctgcgtggaactggggcaagtcgccggatggcgagtggaagccg
ctggatacgaactcggccagcgatgcggatctttggatggcgtatgacctgctggaagcg
gggcgcctttggaaggacgaccgcctgaccaagctgggcgatgtgatgatggaccgcatt
gcgcacactgaggtggcggtttccccgtcgctgggaacggtgttgctgcccggtccgacg
ggattcaaaccgcagccgaacacgatgattctgaatccgagctattcgccgccgcaggtg
ctggcacggctgaaggcggagcagccgtcggggccgtgggaggccgcgctggacgcgttg
ccgcgattgattgcggcgtccgcacccagcggctttgccatggactgggttctctccggt
gcaaagacggtcccgtccgtgtcgccaacggatctggctgcgggtaacacgaccgttgca
ccggtgggtggatttgagtcgattcgcgtgtatctgtggctgggtatggcggacaagggg
acggcggttgtgcagcggtcgctgcagtccgtgggcgggatggcccgtttgatggagagt
acggtgacgccgccgatgcaggtggatgctgctggaacagtcgtgaatgccgatgggccg
gttggattttcggctgctgtgattccgtacctgctggctgtgggacacaaggatcaggcg
accgcgcaggcgaatcggatggctgcgagtgtggactcggcgagcggtctgtatggccgc
acacctctttactatgaccagaacctggcgatgttttcgaatggctggacggagggtcgg
ttcaagttcgaccgcgacggcaagctgaaggtgaagtggaagtga

DBGET integrated database retrieval system