KEGG   Terriglobus roseus: Terro_1433Help
Entry
Terro_1433        CDS       T02140                                 

Definition
endoglucanase Y
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
trs  Terriglobus roseus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:trs00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1691180..1692364
Genome map
AA seq 394 aa AA seqDB search
MLGEAGNKWGWRRWVAVAIALSTLSLQTGCRAEVPWPLWQQYRARFIDGSGRVIDHSPGA
NEKTTSEGMAYGMFFALVVNDRPTFDKLLRWTEDNLAGGDLTARLPAWNWGKSPDGEWKP
LDTNSASDADLWMAYDLLEAGRLWKDDRLTKLGDVMMDRIAHTEVAVSPSLGTVLLPGPT
GFKPQPNTMILNPSYSPPQVLARLKAEQPSGPWEAALDALPRLIAASAPSGFAMDWVLSG
AKTVPSVSPTDLAAGNTTVAPVGGFESIRVYLWLGMADKGTAVVQRSLQSVGGMARLMES
TVTPPMQVDAAGTVVNADGPVGFSAAVIPYLLAVGHKDQATAQANRMAASVDSASGLYGR
TPLYYDQNLAMFSNGWTEGRFKFDRDGKLKVKWK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcgaggcagggaataagtggggatggcgccggtgggttgccgtggcgattgcg
ctgagtaccttgtcgctccagacgggatgccgtgcggaggtgccctggccgctttggcag
cagtaccgcgcgaggtttatcgacggttccggacgcgtgatcgatcacagcccgggggcg
aacgagaagacaaccagcgaaggcatggcgtacggcatgttctttgcactcgtcgtcaac
gaccggcctacgttcgacaagctgctgcgctggacagaggacaacctggcgggcggcgac
cttacggcgcgcctgcctgcgtggaactggggcaagtcgccggatggcgagtggaagccg
ctggatacgaactcggccagcgatgcggatctttggatggcgtatgacctgctggaagcg
gggcgcctttggaaggacgaccgcctgaccaagctgggcgatgtgatgatggaccgcatt
gcgcacactgaggtggcggtttccccgtcgctgggaacggtgttgctgcccggtccgacg
ggattcaaaccgcagccgaacacgatgattctgaatccgagctattcgccgccgcaggtg
ctggcacggctgaaggcggagcagccgtcggggccgtgggaggccgcgctggacgcgttg
ccgcgattgattgcggcgtccgcacccagcggctttgccatggactgggttctctccggt
gcaaagacggtcccgtccgtgtcgccaacggatctggctgcgggtaacacgaccgttgca
ccggtgggtggatttgagtcgattcgcgtgtatctgtggctgggtatggcggacaagggg
acggcggttgtgcagcggtcgctgcagtccgtgggcgggatggcccgtttgatggagagt
acggtgacgccgccgatgcaggtggatgctgctggaacagtcgtgaatgccgatgggccg
gttggattttcggctgctgtgattccgtacctgctggctgtgggacacaaggatcaggcg
accgcgcaggcgaatcggatggctgcgagtgtggactcggcgagcggtctgtatggccgc
acacctctttactatgaccagaacctggcgatgttttcgaatggctggacggagggtcgg
ttcaagttcgaccgcgacggcaagctgaaggtgaagtggaagtga

DBGET integrated database retrieval system