KEGG   Terriglobus roseus: Terro_1695Help
Entry
Terro_1695        CDS       T02140                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
trs  Terriglobus roseus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Terro_1695
Enzymes [BR:trs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Terro_1695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1993488..1995104
Genome map
AA seq 538 aa AA seqDB search
MISERLSGVLLHVTSLPSNGGIGDFGPAAYAFVDYLAQAEQRLWQVLPLNPVGYGNSPYS
ALSAFAGNPLLISLEELQKAGWLYAGEAEGLAGANGPVDFARAITEKIPLIHRAAKRFLQ
SSNSQQCQAFEKFREASRAWLVDYARFTILRRQNNFVHWNEWPTELAAHDADALAKFDAE
HKEDLEIEYATQFFFTEQWTALRAFCTTRDIRVMGDMAIFVSYDSADVWANKEIFDLDEQ
YKPIAVSGVPPDYFSATGQRWGNPLYRWRYLEQHGFDWWVERVKRQLELYDLLRLDHFRG
FEAYWRIPADEETAMNGEWVEAPGFALFDRLKSALGGSLPFIAEDLGVITDKVDKLRCDF
SMPGMRVLQFGFAGRGAHLHLPHKYDRNTVCYTGTHDNDTTLGWWMSAGEDDRKNLLTYL
GPLAHPNDVVWAMIRCAQRSVASLCIIPLQDLLHLGPEGRMNTPGAPENNWTWRYHPEAL
HPDIGMQLRHITEECDRDAYIPESAAQEVASMPSPPEALSDQTGEQQGTAAETIAPTA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgatctctgaacggctctccggtgtactcctgcacgtcacctcgctgccttccaacggc
ggaatcggtgactttggccctgcggcttatgcgttcgtcgactatcttgcgcaagccgaa
cagcggctgtggcaggtgctgcctttaaatccggtgggctatggcaactcgccatactcg
gcgttatccgccttcgcaggcaatccgcttctcatcagcctggaagaactccagaaggca
ggatggctctacgctggagaggccgaaggcctcgccggcgcaaacgggccagtcgacttc
gctcgagccattacagagaagattcccctcatccatcgcgcggcgaaacggttcctgcag
agcagcaacagccagcagtgccaggccttcgagaagtttcgcgaagcaagccgggcatgg
ctcgtggactacgcacgcttcaccatcctgcgccgtcagaacaacttcgtgcactggaac
gagtggcccacagaactcgccgcgcatgacgccgacgctttggcgaagttcgacgcggaa
cacaaggaagatctcgagatcgagtacgcaacccagttcttcttcacggaacagtggacc
gctctccgcgccttctgcaccacgcgcgacattcgcgtcatgggcgacatggccatcttc
gtctcctacgattcggccgatgtctgggcaaacaaggagatcttcgatctcgacgaacag
tacaagcccatcgccgtctcgggtgtgccgccggattacttctcggcgaccggccagcgc
tggggtaaccccctctaccgctggcgttacctcgaacagcacggcttcgactggtgggtg
gaacgtgtcaaacgccagctcgagctatacgaccttctgcgcctcgatcacttccgcggc
tttgaagcctactggcgcattcccgccgacgaagagaccgcaatgaacggcgaatgggtc
gaggcaccgggcttcgcgctcttcgaccgcctcaagtccgccctcggtggatcgctgcca
ttcatcgcagaagacctcggcgtcatcacggataaggtcgacaagctccgttgcgatttc
agcatgcccggaatgcgcgtccttcagttcggttttgccggtcgcggagcgcacctccat
ctgccgcataagtacgaccgcaacaccgtctgctacaccggcacccacgacaacgacacc
acgcttggctggtggatgagcgcaggcgaagacgaccgcaagaacctgcttacctacctc
ggtccgctggctcacccaaacgatgtcgtctgggcgatgatccgctgtgcgcaacgatcc
gtcgcctcgctctgcatcatcccgttgcaggacctgttgcatctgggaccggaaggccgt
atgaatacacccggtgctcccgagaataactggacgtggcgctaccacccggaagcgctg
catccggacatcggcatgcagcttcgccacatcacggaagaatgcgatcgtgacgcctac
attccggaatcggcggcgcaggaagtggcgtccatgccctctccgcccgaggccctctca
gatcaaaccggcgaacagcagggaactgccgctgaaaccattgctcccacggcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system