KEGG   Terriglobus roseus: Terro_1776Help
Entry
Terro_1776        CDS       T02140                                 

Definition
galactose mutarotase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
trs  Terriglobus roseus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Terro_1776
   00052 Galactose metabolism
    Terro_1776
Enzymes [BR:trs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Terro_1776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2103858..2104958
Genome map
AA seq 366 aa AA seqDB search
MLKRTLFVLLLVSAGIVAHAEVTRASFGNMPDGRAVDVFTLTSRNVEAKVITYGARLIDI
RTPDRNGKIADVMLGYDTLPEWLADRGSYNGSIVGRYGNRIANGRFTIDGKEYQVPPNDG
PNALHGGRGGFDKKLWTAKQLPDGVELTLVSPDGDMGLPGTLTAQVTYTLKGNALKIDYK
ATTDKPTVVNLTNHTYFNLTGTDEDVLGHQLIIHGDRYTPTSKTLIPTGKLDSVANTPMD
FRTSHTIGERIAAPFEALTMGGGYDHNWVLNGPDGVLKPAADVYEPKSGRTLKVTTTQPG
VQFYSGNFLNGMLTGRGGIKYTKHMGFCLETQHFPDSPNEPSFPSTVLRPGQTASSTTIF
TFGIKK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagagaacgttgttcgtgcttctgcttgtctctgcagggatcgtcgcgcacgcc
gaggtcaccagggcatcgttcggcaatatgccggatggccgcgcggtcgacgtcttcacg
ttgacgagccggaacgtcgaggcaaaggtgatcacctacggcgcgcgcctgatcgacatc
cgcacgccggaccgcaatggcaagatcgccgacgtcatgctcgggtacgacacgctgcct
gagtggctcgccgacaggggctcttacaacggctccatcgttggtcgctacggcaatcgc
atcgcgaacggccgcttcaccattgacgggaaggaataccaggtgccgccgaacgacggc
ccaaacgccctgcacggcggccgaggcggcttcgataagaagctctggacagcgaagcag
ctaccggacggcgtggaactcacgctggtttcgcccgacggcgacatgggccttcccggc
acgctgaccgcacaagtcacgtacacgctcaagggaaatgcgctcaagatcgactacaag
gcgacaaccgacaagccaactgtggtcaacctgacgaaccacacctacttcaatctcacg
ggcacggacgaagatgtcctggggcatcagctcatcatccacggtgaccgctacacgccc
acatcgaagacgctcatccccaccggcaagctggactccgtagccaacactccgatggac
ttccgcaccagccacaccatcggggagcgcattgccgcaccatttgaggcgctgacgatg
ggcggtggctacgatcacaactgggttctgaacggaccggacggcgtgttgaagccagcc
gcggacgtctacgaaccgaagagcggcagaacgctcaaggtcacgacgacgcaacccggc
gtgcagttctactctggtaacttcctcaacggtatgctgaccggtcgcggtggcatcaag
tacacaaagcacatgggcttctgcctggagacgcaacacttcccggattcgccgaacgag
cccagcttcccatccaccgtcctgaggcccggtcagacggcgagctcaaccaccatcttc
accttcggcatcaagaagtag

DBGET integrated database retrieval system