KEGG   Terriglobus roseus: Terro_1857Help
Entry
Terro_1857        CDS       T02140                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
trs  Terriglobus roseus
Brite
Enzymes [BR:trs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Terro_1857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2191166..2192308
Genome map
AA seq 380 aa AA seqDB search
MVGAVVLSGCGPRRVGGSPALAGVDVGGKASLKEHAANARLLFGFAVDTRQLRENRRYRE
VVEQQASIIVAENAMKWRALRPAVDRYDFEDADGLLTFAEKNRIKLRGHNLCWHESLPVW
FDAVANRGNAHRLLVDHIRTVAGRYAGRMHSWDVVNEAINTRDGRGDGLRNSPWLRLVGT
DYIEIAFRTAREADPAALLTYNEFGLEPETVEGAGKRAATLQMLRRLKQRNVPIDAVGIQ
SHLEAGSRSGYGPELTKFMAACREMGLEIFLSEMDVSDRNLPVNTDSRDAVVAESYRSYL
EMTLQERRVTAVLTWGVDDGGTWLTAGEPRRDQSAQRPLLFDSSFQAKPAFAAVREAFVG
RMRPGSGASAARVPAYLPRL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggttggggctgtggttttgtcgggttgtgggccgcggcgtgtgggtggttcgcctgcg
ctggcgggcgtcgatgttggagggaaggcgtcgctgaaggagcatgcggcgaatgcccgg
ctgctatttggctttgcggtggatactcggcaactgcgggagaatcgccggtatcgggaa
gtagtcgagcagcaggcttcgatcatcgtggcggagaatgcgatgaagtggcgggcgctg
cggccggcggtggatcggtatgactttgaggatgccgatgggctgctgacgttcgcggag
aagaatcgcatcaagctgcgggggcataacctttgctggcatgagtctttgccagtgtgg
ttcgatgccgtggcgaatcgggggaatgcgcaccggttgctggtggatcacattcggacg
gtggcggggcggtatgcgggtcgcatgcactcgtgggatgtggtgaatgaggcgatcaac
actcgcgatgggcgtggggatgggttgaggaattcgccctggctgcggctggtggggacg
gactatatcgagattgctttccgcacggctcgtgaggcggatcctgctgctttgctgacc
tataacgagtttgggttggagccggagacggtggaaggtgcagggaagcgcgcggctacg
ctgcagatgttgcggcggttgaagcagcggaatgtgccgatcgatgccgttgggatccag
tcgcatctggaggctggttcgcggagcggctatgggccggagctgacgaagtttatggct
gcgtgtcgcgagatgggacttgagatctttttgtcggagatggatgtcagcgaccggaat
ctgccggtgaacacggatagccgcgatgcggtggtggccgagagctatcggtcttatttg
gagatgacgcttcaggagcgcagggtaactgcggtgctgacctggggtgtggatgatggt
gggacgtggctgaccgcgggggaaccgcggagggatcagtcggcgcaacggccgctactg
tttgatagcagcttccaggcgaagccggcgtttgctgcagtgcgtgaggcgtttgttggg
cggatgcggccggggtcgggtgcgagtgcggctcgtgtgcctgcttacttgcctcgcttg
tag

DBGET integrated database retrieval system