KEGG   Terriglobus roseus: Terro_2095Help
Entry
Terro_2095        CDS       T02140                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
trs  Terriglobus roseus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:trs01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:trs00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:trs00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2481262..2482851
Genome map
AA seq 529 aa AA seqDB search
MQTIEFKTPLTPADEQILTPDAVNFLTALHRNFNARRLELLQARIARQAHLDAGERPDFL
PETASIRSAAWRCAPIPADLQDRRVEITGPVERKMVINALNSGAKVFMADFEDSTTPTWT
NLLEGQANLRDAVRRTITFEAPETGKSYKLNEKTAVLFVRPRGWHLPEQHMIVDGEPMSG
SLFDFGLYLFHNATELLARGSGPYFYLPKMESHLEARLWNDAIVFAQNYIGVPQGSVRAT
VLIETILATFEMDEILYELRDHSAGLNCGRWDYIFSFIKKLAADKTILLPDRGQVTMATH
FMRSYSKLAIKTCHHREISAMGGMSAFIPIKSDPEANERALAQVRADKEREAGDGHDGTW
VAHPGLVPIAMEVFDRLMPGPNQIDKKLDDYTATATDLLQIPTGQITEAGLRQNVAVGLG
YVEAWLRGIGCVPLFNLMEDAATAEISRAQLWQWVHHGAVLADGRAVTADLVDSVIDDEL
SKTRSAVDAKRFAAYERAALMMRDLVRSDRFTDFLTLPAYESVLKEGLA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccattgaattcaagacgccgcttacgcccgctgacgaacagatcctcacaccg
gacgccgtcaacttcctgacggcactccaccgtaacttcaacgcccgccggctcgagctg
ctgcaggcccgcatcgctcgccaggcgcacttggacgcaggcgaacgccctgacttcctg
ccggagaccgccagcattcgcagtgccgcttggcgctgcgcaccgatccctgctgacctc
caggaccgtcgcgtcgagatcaccgggcctgtcgaacgcaagatggtgatcaacgcgctg
aacagcggtgcgaaggtcttcatggcggactttgaagactccaccacacccacctggacc
aacctcctcgaaggtcaggcaaacctgcgggacgccgtccgccgcaccatcaccttcgaa
gccccggagacgggcaaaagctacaagctcaacgagaagacagcagtgctcttcgtacgg
ccgcgcggctggcatctgccggaacagcacatgatcgtggatggcgagccgatgagcggc
tccctcttcgatttcggcctctacctctttcacaacgcgacagagctgcttgcacgcggc
tccggaccgtacttctacctacccaagatggaatcgcatctggaagcgcggctgtggaac
gacgccatcgtcttcgcgcagaactacatcggcgtgccgcaaggctccgtccgcgcaacc
gtgctgatcgagaccatcctcgcgaccttcgaaatggacgagatcctctatgaactgcgc
gaccactcggccggcctcaactgcggtcgctgggactacatcttctcgttcatcaagaag
ctcgccgcagacaagaccatcctcctgccggatcgcggacaggtcaccatggcgacccat
ttcatgcggtcgtactcgaagctcgccatcaagacctgtcaccaccgcgaaatcagcgcc
atgggcggcatgagcgccttcatccccatcaagagcgatcccgaggcaaacgaacgcgct
ctcgcgcaggtccgcgccgacaaggagcgcgaagcaggcgacggacacgacggcacatgg
gtcgcgcatcccggcctcgtacccatcgccatggaggtcttcgaccgcctgatgccggga
ccaaaccagatcgataagaagctcgacgactacaccgcaaccgcgacggacctgctccag
atcccgaccggccagatcaccgaggccggtcttcgtcaaaacgtggcggtcggtctgggc
tacgtcgaagcttggctgcgcggcatcggctgtgtccctctcttcaacctgatggaggat
gccgcgaccgcagagatcagccgcgcccagctctggcaatgggtccaccatggcgctgtg
ctggccgacggccgcgccgtcacggcagatctggtcgacagcgtcattgacgacgaactg
agcaagaccaggtcagccgtagacgcgaagcgctttgcagcctacgaacgcgccgcgctc
atgatgcgcgacctcgttcgcagtgaccgcttcacggacttcctgacgctgcccgcgtac
gaatcggtcctcaaagaaggtctggcgtag

DBGET integrated database retrieval system