KEGG   Terriglobus roseus: Terro_2121Help
Entry
Terro_2121        CDS       T02140                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
trs  Terriglobus roseus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:trs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Terro_2121
DNA repair and recombination proteins [BR:trs03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Terro_2121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2512568..2513173
Genome map
AA seq 201 aa AA seqDB search
MERFAQPMARLIEELRKLPGVGNKSAQRLAFHILRSPNADAELLANAIRELKAQLRLCSI
CNNVTDVDPCTYCSSPTRTHATVCVVEEPTSIASIEKTRGYNGIYHVLHGTLSPLNGVGP
EQLRTANLFSRLGEIDEIILALSPTVEGEATSHWLANQLHQASADHPLRITRIATGVPAG
SDIEYADEITMSRAMEGRREI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcttcgcacaaccgatggcccgcctgatcgaagagctgcgcaagctgcccggc
gtcggcaacaaatccgcacaacgtctggccttccacatcctgcgctcgcccaacgccgac
gcggaactgctcgccaacgccatccgcgaactcaaagcgcaactgcggctttgcagtatc
tgcaacaacgtcaccgacgtcgatccctgcacctactgctcctcccccacccgcacgcac
gctacggtctgcgtcgtcgaagagccaaccagcatcgcgtccatcgaaaagacccgcggc
tacaacggcatctatcacgtcctccacggcacgctctccccgctcaacggcgtcggcccg
gaacaactgcgcaccgccaacctcttcagccgcctcggcgagatcgacgaaatcatcctc
gccctttcgcccaccgtcgagggagaagcaacatcacactggctcgcaaaccaactccat
caggccagtgccgaccatccgctgcgcatcacgcgtattgccaccggagtccccgcaggc
agcgacatcgagtacgccgacgaaatcaccatgagccgggcaatggaaggccgtcgcgag
atatag

DBGET integrated database retrieval system