KEGG   Terriglobus roseus: Terro_2121Help
Entry
Terro_2121        CDS       T02140                                 

Definition
(GenBank) DNA replication and repair protein RecR
  KO
K06187  recombination protein RecR
Organism
trs  Terriglobus roseus
Pathway
trs03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:trs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Terro_2121
DNA repair and recombination proteins [BR:trs03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Terro_2121
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Terro_2121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 HHH_8 IMS_HHH
Motif
Other DBs
NCBI-ProteinID: AFL88393
UniProt: I3ZHL5
Position
2512568..2513173
Genome map
AA seq 201 aa AA seqDB search
MERFAQPMARLIEELRKLPGVGNKSAQRLAFHILRSPNADAELLANAIRELKAQLRLCSI
CNNVTDVDPCTYCSSPTRTHATVCVVEEPTSIASIEKTRGYNGIYHVLHGTLSPLNGVGP
EQLRTANLFSRLGEIDEIILALSPTVEGEATSHWLANQLHQASADHPLRITRIATGVPAG
SDIEYADEITMSRAMEGRREI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcttcgcacaaccgatggcccgcctgatcgaagagctgcgcaagctgcccggc
gtcggcaacaaatccgcacaacgtctggccttccacatcctgcgctcgcccaacgccgac
gcggaactgctcgccaacgccatccgcgaactcaaagcgcaactgcggctttgcagtatc
tgcaacaacgtcaccgacgtcgatccctgcacctactgctcctcccccacccgcacgcac
gctacggtctgcgtcgtcgaagagccaaccagcatcgcgtccatcgaaaagacccgcggc
tacaacggcatctatcacgtcctccacggcacgctctccccgctcaacggcgtcggcccg
gaacaactgcgcaccgccaacctcttcagccgcctcggcgagatcgacgaaatcatcctc
gccctttcgcccaccgtcgagggagaagcaacatcacactggctcgcaaaccaactccat
caggccagtgccgaccatccgctgcgcatcacgcgtattgccaccggagtccccgcaggc
agcgacatcgagtacgccgacgaaatcaccatgagccgggcaatggaaggccgtcgcgag
atatag

DBGET integrated database retrieval system