KEGG   Terriglobus roseus: Terro_2159Help
Entry
Terro_2159        CDS       T02140                                 

Definition
Alpha amylase, catalytic domain protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
trs  Terriglobus roseus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Terro_2159
Enzymes [BR:trs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Terro_2159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2560921..2562246
Genome map
AA seq 441 aa AA seqDB search
MILYDCLYPKIKSGWYERLRTFAGVFADFGGDLILLPPPFRTTYTGSDNMSLGYDPISDL
DIGQWESLRGGTAEDLQSLAREALRHGLRLMFDLPMHQYGGFPIVERNGKGKRDRKLAYK
PSFLFRAAPDQNFERAPADGLRVPYQHSKPADYLRKMKIQCTAWLMHVTAGFGLRLDEAK
DMDMNLTHRLAASIPGFKVAEAYTGSNAQLDSYHRQSGLPVFDFGSHFAYRAVSQGAGLD
ALVYTDRYCHMNPSAAVPFVDNHDTDGADGVVNFKGWFYLDACTQAALACSIYAGDYELY
GLAPLIDNYLWIGKRLAVGNQAYHVISPDVLIWSRDGNGGELGNAAGVLCGISRDPFNTR
WVWTDTPWRNCWIRNYARSGGPNVWVYPDGRACIPLPPNSFSRADNGVAYSLLNQDGPLP
KRELHIPLRNPLDFSGITVTL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtgatcctttacgactgtctctatcccaagatcaagagtggctggtacgaacgcctgcgc
acatttgcgggcgtgtttgctgacttcggcggagatctgattctgttgccaccgcccttt
cgcacgacttataccgggtcagataacatgagcctcggctacgatcccataagcgatctg
gatattgggcagtgggaaagtttgcgcggtggcaccgcggaggatctgcagtcactcgcg
cgggaggcccttcgccacggcctgcgtctcatgttcgatctgccgatgcatcaatatggc
ggctttccgatcgttgagcgtaacggcaagggaaagcgcgaccgaaagctcgcctacaag
ccatccttcctcttccgcgctgcacccgaccagaacttcgagcgtgcgccagcggatggc
ttacgggttccctatcaacactcaaagcccgcggactacttgcgcaaaatgaagattcaa
tgcacagcatggcttatgcacgtcacagcgggctttggcttgcgtcttgatgaagccaaa
gatatggacatgaaccttacgcacaggctggcggcaagtattccaggattcaaggttgcc
gaggcttacaccggcagtaatgcacaactcgattcctatcaccggcaatccggcctcccc
gtcttcgactttggcagccatttcgcgtatcgagccgtaagtcagggtgctggtctggac
gcactcgtctacacggatcgctattgccacatgaatccttcggcagcggttcccttcgtg
gacaaccacgacaccgatggtgccgatggcgtggtcaacttcaaaggatggttctatctg
gatgcctgcacgcaggctgcgttagcctgcagtatctacgccggcgactatgagttgtac
ggcctcgcccccttgattgataactatctctggatcggcaagcgtctcgctgtcggtaat
caggcttaccacgtgatcagccccgacgttttgatctggtcgcgtgatggcaatggtggt
gagcttggcaacgcggccggggtgttgtgcggtatctcacgcgatccgttcaacacgcgc
tgggtatggacggacactccgtggcgtaactgctggatcaggaattacgcgcgaagcggt
ggccctaacgtatgggtgtaccctgacggtcgcgcttgcatcccgcttccacccaatagc
ttcagtcgcgcggataacggtgtcgcatacagcctgctcaatcaggatgggccgctgcca
aagcgcgagttgcatattccccttcgaaacccgctcgacttttcaggaattacggtgact
ttatga

DBGET integrated database retrieval system