KEGG   Terriglobus roseus: Terro_2197Help
Entry
Terro_2197        CDS       T02140                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
trs  Terriglobus roseus
Pathway
trs00010  Glycolysis / Gluconeogenesis
trs00071  Fatty acid degradation
trs00350  Tyrosine metabolism
trs00625  Chloroalkane and chloroalkene degradation
trs00626  Naphthalene degradation
trs01100  Metabolic pathways
trs01110  Biosynthesis of secondary metabolites
trs01120  Microbial metabolism in diverse environments
trs01130  Biosynthesis of antibiotics
trs01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Terro_2197
  Lipid metabolism
   00071 Fatty acid degradation
    Terro_2197
  Amino acid metabolism
   00350 Tyrosine metabolism
    Terro_2197
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Terro_2197
   00626 Naphthalene degradation
    Terro_2197
Enzymes [BR:trs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Terro_2197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_2 2-Hacid_dh_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AFL88462
UniProt: I3ZGU4
Position
2611801..2612808
Genome map
AA seq 335 aa AA seqDB search
MIPTTMRAAVFHGTRHDGAPPLTIEERPVPTPAEGESLLKVLACGVCRTDLHIVEGDLPF
HLPSVIPGHQIVGEVVTTSSSQFQVGDRVGVSWMGGTDGTCKFCKSNRENLCDAIAFTGY
SRDGGYAEYVTARTDFLIPLTTALPPQIAAPLLCAGMIGFRSLRVAEVKPGQKVGIFGFG
ASARLVMPVLHMWGCEVYVATRGERHRQEAAAMGATWVGDAFDLPPTPLDAAVIFAPVGS
VVLAGLKSLDKGGILSINAIHLDQMPAFDYDTILWHERQIRSVANMTRQDAKDFMSIAEK
IRITPAIKVFSLEQANEALAAIKDEDVVGSAVIVP
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgaccaccatgcgcgccgcagtcttccacggaacacgtcacgacggcgcgccc
cctctcaccatcgaagaaaggccggtgcccacaccggccgagggcgagagtctccttaag
gtcctggcctgcggtgtctgtcgaacagacctgcatatcgtggaaggcgatctcccattt
catctaccttctgtcatccctggtcatcagatcgtcggcgaagtcgtcacgacatccagc
agccagtttcaagtgggtgatcgcgtcggtgtctcatggatgggcggaacagacggcacc
tgtaagttctgcaaaagcaacagagagaacctctgcgacgccatcgccttcaccggttat
tcgcgtgatggtggctatgccgaatatgtaactgcccgcacggatttcctgatcccactt
acgaccgccctccctccgcaaatcgctgcgccgctcctctgtgcaggcatgatcggcttc
cgcagcttgcgtgtggccgaggtcaagcccggtcagaaggtaggcatcttcggcttcggt
gcgtcggcacgcttggtcatgcccgtccttcacatgtgggggtgtgaagtctacgtcgca
acacgcggcgaacgccatcgtcaggaagccgcggccatgggcgccacatgggttggcgac
gccttcgatctaccgcccacgcctctcgatgcagccgttatcttcgcgccggttggcagc
gtcgtcctcgccggcctcaagtcgctcgacaaaggcggcatcctctccatcaacgccatt
catctcgatcagatgcccgccttcgactacgacaccatcctctggcacgaacgacagatt
cgaagcgtcgccaacatgacccggcaggatgcaaaagacttcatgagcatcgcggagaag
attcgaatcacacccgccatcaaggtcttctcactcgaacaagccaatgaggcactcgca
gccatcaaggacgaagacgtcgtcggttccgcagtcatcgttccttga

DBGET integrated database retrieval system